Property Summary

NCBI Gene PubMed Count 58
PubMed Score 144.46
PubTator Score 101.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis -1.100 1.4e-05
osteosarcoma 1.940 1.1e-03
group 3 medulloblastoma 1.500 6.5e-04
atypical teratoid / rhabdoid tumor 1.600 1.4e-04
glioblastoma 1.300 1.7e-03
medulloblastoma, large-cell -2.000 8.6e-03
tuberculosis -1.500 1.0e-04
intraductal papillary-mucinous adenoma (... 1.900 7.9e-05
intraductal papillary-mucinous carcinoma... 1.300 2.8e-03
intraductal papillary-mucinous neoplasm ... 1.200 2.9e-02
breast carcinoma 1.100 6.5e-03
lung adenocarcinoma 1.438 4.5e-07
ovarian cancer -1.900 1.2e-06
Down syndrome 1.200 5.4e-04

Gene RIF (45)

PMID Text
26819089 UTX positively regulates E-cadherin expression in colon cancer cells.
26431949 Turner Syndrome subjects, who are predisposed to chronic ear infections, had reduced UTX expression in immune cells and decreased circulating CD4(+) CXCR5(+) T cell frequency.
26303947 UTX is a prominent tumour suppressor that functions as a negative regulator of EMT-induced Cancer Stem Cell-like properties by epigenetically repressing epithelial-mesenchymal transition -TFs.
26138514 The KDM6A gene is a histone demethylase specific for histone H3 Lysin 27 and regulates gene transcription [35]. In approximately 24% of urothelial carcinoma, KDM6A is altered.
26049589 Kabuki syndrome may be caused by mutations in one of two histone methyltransferase genes: KMT2D and KDM6A.
25972376 Our results provide further support for the similar roles of KMT2D and KDM6A in the etiology of KS by using a vertebrate model organism to provide direct evidence of their roles in the development of organs and tissues affected in KS patients.
25320243 H3K27me3 demethylase UTX is a gender-specific tumor suppressor in T-cell acute lymphoblastic leukemia
25281733 Mutations in KMT2D gene were identified in 10/16 (62%) of the patients, whereas none of the patients had KDM6A mutations.
25225064 This study is the first to identify frequent BAP1 and BRCA pathway alterations in bladder cancer, show TERT promoter alterations are independent of other bladder cancer gene alterations, and show KDM6A loss is a driver of the bladder cancer phenotype.
25071154 Results show that UTX interacts with the retinoic acid receptor alpha (RARalpha) and this interaction is essential for proper differentiation of leukemic U937 cells in response to retinoic acid.
24739679 One girl had a novel splice-site mutation in KDM6A.
24527667 A report of novel KDM6A mutations in patients with Kabuki syndrome.
24491801 High levels of UTX or MLL4 are associated with poor prognosis in patients with breast cancer.
24465480 results demonstrate that UTX is implicated in IL-4 mediated transcriptional activation of the ALOX15 gene
24123378 Both Ezh2 and Kdm6a were shown to affect expression of master regulatory genes involved in adipogenesis and osteogenesis.
23913813 The identification of novel KDM6A mutations in patients with Kabuki syndrome.
23644518 PBRM1, KDM6A, SETD2 and BAP1 were unmethylated in all tumor and normal specimens.
23527641 UTX histone demethylase plays important functional role in epigenetic alteration of HOX clusters during retinoic acid-induced neural differentiation.
23365460 UTX regulates stem cell migration and hematopoiesis.
23266085 KDM6A is overexpressed in breast cancer patients with an unfavorable prognosis (mortality at 1 year, p=8.65E-7).
23184418 This study demonistrated that KDM6A mutations were most commonly identified in subgroups in medulloblastoma.
22907667 KDM6A contributes to the activation of WNT3 and DKK1 at different differentiation stages when WNT3 and DKK1 are required for mesendoderm and definitive endoderm differentiation.
22840376 Microdeletions and microduplications have not been identified in the MLL2 and KDM6A genes of a large cohort of patients with Kabuki syndrome.
22801502 identification of Utx as a novel mediator with distinct functions during the re-establishment of pluripotency and germ cell development
22589717 PAN RNA interacts with demethylases JMJD3 and UTX, and the histone methyltransferase MLL2
22306297 demonstrate that UTX directly associates with the promoters of the Mll1, Runx1, and Scl genes and modulate their transcription by controlling H3K27me3 marks on respective promoter regions.
22197486 This study identifies KDM6A mutations as another cause of Kabuki syndrome and highlights the growing role of histone methylases and histone demethylases in multiple-congenital-anomaly and intellectual-disability syndromes.
22002947 clarified how UTX discriminates H3K27me3/2 from the other methyllysines with distinct roles
21865393 Correlating with the loss of H3K27me3, human papillomavirus 16 E6/E7-expressing cells exhibited derepression of specific EZH2-, KMD6A-, and BMI1-targeted HOX genes.
21841772 H3K27 demethylation by JMJD3 at a poised enhancer of anti-apoptotic gene BCL2 determines ERalpha ligand dependency
21828135 Novel UTX, DNMT3A, and EZH2 mutations were found in 8%, 10%, and 5.5% of patients with chronic myelomonocytic leukemia.
21575637 inhibition measurements showed significant selectivity between KDM4C and KDM6A
21515470 UXT is a potential interactor of HBV Pol.
21245294 KDM6A- and KDM6B-responsive Homeobox genes are expressed at significantly higher levels, suggesting that HPV16 E7 results in reprogramming of host epithelial cells
21209387 The role of the H3K27 demethylases Jmjd3 and UTX in gene expression, is discussed.
20442750 Observational study of gene-disease association. (HuGE Navigator)
20123895 UTX removes H3K27me3 and maintains expression of several RB-binding proteins, enabling cell cycle arrest
20054297 identification of inactivating mutations in two genes--SETD2, a histone H3 lysine 36 methyltransferase, and JARID1C, a histone H3 lysine 4 demethylase--as well as mutations in the histone H3 lysine 27 demethylase, UTX in clear cell renal cell carcinoma
19330029 Here, we describe inactivating somatic mutations in the histone lysine demethylase gene UTX, pointing to histone H3 lysine methylation deregulation in multiple tumor types
18003914 UTX and JMJD3 may function as H3K27 demethylases in vivo
18003914 The JmjC domain-containing protein UTX specifically demethylates mono-, di- and trimethylated K27 of histone H3 in vitro.
17851529 critical role for UTX in regulating H3K27 methylation at the HOX gene loci and in animal posterior development
17761849 study shows that UTX is a di- and trimethyl H3K27 demethylase; results suggest a concerted mechanism for transcriptional activation in which cycles of H3K4 methylation by MLL2/3 are linked with the demethylation of H3K27 through UTX
17713478 the human JmjC-domain-containing proteins UTX and JMJD3 demethylate tri-methylated Lys 27 on histone H3
17500065 UTX associates with MLL3- and MLL4-containing histone H3 K4 methyltransferase complex(es) that also include ASH2L, RBBP5, WDR5, hDPY-30, PTIP, PA1, NCOA6.

AA Sequence

MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTK      1 - 70
ALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGLVY     71 - 140
FHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFH    141 - 210
IAHLYETQRKYHSAKEAYEQLLQTENLSAQVKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEAD    211 - 280
PNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHG    281 - 350
HAAAWMDLGTLYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQAQLCNLPQGSLQNKTKLLPSIE    351 - 420
EAWSLPIPAELTSRQGAMNTAQQNTSDNWSGGHAVSHPPVQQQAHSWCLTPQKLQHLEQLRANRNNLNPA    421 - 490
QKLMLEQLESQFVLMQQHQMRPTGVAQVRSTGIPNGPTADSSLPTNSVSGQQPQLALTRVPSVSQPGVRP    491 - 560
ACPGQPLANGPFSAGHVPCSTSRTLGSTDTILIGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEE    561 - 630
PWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLS    631 - 700
SHTATSGGQQGITLTKESKPSGNILTVPETSRHTGETPNSTASVEGLPNHVHQMTADAVCSPSHGDSKSP    701 - 770
GLLSSDNPQLSALLMGKANNNVGTGTCDKVNNIHPAVHTKTDNSVASSPSSAISTATPSPKSTEQTTTNS    771 - 840
VTSLNSPHSGLHTINGEGMEESQSPMKTDLLLVNHKPSPQIIPSMSVSIYPSSAEVLKACRNLGKNGLSN    841 - 910
SSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLD    911 - 980
LGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREE    981 - 1050
NEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLS   1051 - 1120
HVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLM   1121 - 1190
GSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNK   1191 - 1260
LQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHY   1261 - 1330
CSICEVEVFDLLFVTNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSAS   1331 - 1400
S//

Text Mined References (63)

PMID Year Title
26819089 2016 Epigenetic regulation of E-cadherin expression by the histone demethylase UTX in colon cancer cells.
26431949 2015 T Follicular Helper Cell-Dependent Clearance of a Persistent Virus Infection Requires T Cell Expression of the Histone Demethylase UTX.
26303947 2015 UTX inhibits EMT-induced breast CSC properties by epigenetic repression of EMT genes in cooperation with LSD1 and HDAC1.
26138514 2015 Beyond conventional chemotherapy: Emerging molecular targeted and immunotherapy strategies in urothelial carcinoma.
26049589 2015 Kabuki syndrome: expanding the phenotype to include microphthalmia and anophthalmia.
25972376 2015 Kabuki syndrome genes KMT2D and KDM6A: functional analyses demonstrate critical roles in craniofacial, heart and brain development.
25320243 2015 The H3K27me3 demethylase UTX is a gender-specific tumor suppressor in T-cell acute lymphoblastic leukemia.
25281733 2015 Kabuki syndrome: clinical and molecular diagnosis in the first year of life.
25225064 2014 Concurrent alterations in TERT, KDM6A, and the BRCA pathway in bladder cancer.
25071154 2014 Role of UTX in retinoic acid receptor-mediated gene regulation in leukemia.
24739679 2014 Identification of KMT2D and KDM6A mutations by exome sequencing in Korean patients with Kabuki syndrome.
24527667 2015 Novel KDM6A (UTX) mutations and a clinical and molecular review of the X-linked Kabuki syndrome (KS2).
24491801 2014 UTX and MLL4 coordinately regulate transcriptional programs for cell proliferation and invasiveness in breast cancer cells.
24465480 2014 Interleukin-4-mediated 15-lipoxygenase-1 trans-activation requires UTX recruitment and H3K27me3 demethylation at the promoter in A549 cells.
24123378 2014 EZH2 and KDM6A act as an epigenetic switch to regulate mesenchymal stem cell lineage specification.
23913813 2013 MLL2 and KDM6A mutations in patients with Kabuki syndrome.
23644518 2013 Aberrant promoter hypermethylation of PBRM1, BAP1, SETD2, KDM6A and other chromatin-modifying genes is absent or rare in clear cell RCC.
23527641 2013 Retinoic acid dependent histone 3 demethylation of the clustered HOX genes during neural differentiation of human embryonic stem cells.
23365460 2013 The histone demethylase UTX regulates stem cell migration and hematopoiesis.
23266085 2013 Histone lysine demethylases in breast cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184418 2013 Aberrant patterns of H3K4 and H3K27 histone lysine methylation occur across subgroups in medulloblastoma.
22907667 2013 Histone H3K27me3 demethylases KDM6A and KDM6B modulate definitive endoderm differentiation from human ESCs by regulating WNT signaling pathway.
22840376 2012 Absence of deletion and duplication of MLL2 and KDM6A genes in a large cohort of patients with Kabuki syndrome.
22801502 2012 The H3K27 demethylase Utx regulates somatic and germ cell epigenetic reprogramming.
22589717 2012 KSHV PAN RNA associates with demethylases UTX and JMJD3 to activate lytic replication through a physical interaction with the virus genome.
22306297 2012 A functional role for the histone demethylase UTX in normal and malignant hematopoietic cells.
22197486 2012 Deletion of KDM6A, a histone demethylase interacting with MLL2, in three patients with Kabuki syndrome.
22002947 2011 Structural basis for histone H3 Lys 27 demethylation by UTX/KDM6A.
21865393 2011 Evidence for alteration of EZH2, BMI1, and KDM6A and epigenetic reprogramming in human papillomavirus type 16 E6/E7-expressing keratinocytes.
21841772 2011 H3K27 demethylation by JMJD3 at a poised enhancer of anti-apoptotic gene BCL2 determines ER? ligand dependency.
21828135 2011 Mutational spectrum analysis of chronic myelomonocytic leukemia includes genes associated with epigenetic regulation: UTX, EZH2, and DNMT3A.
21575637 2011 Enzyme kinetic studies of histone demethylases KDM4C and KDM6A: towards understanding selectivity of inhibitors targeting oncogenic histone demethylases.
21515470 2011 [Identification of ubiquitously expressed transcript as the potential interactor of hepatitis B virus polymerase].
21245294 2011 Human papillomavirus E7 oncoprotein induces KDM6A and KDM6B histone demethylase expression and causes epigenetic reprogramming.
21209387 2010 Role of H3K27 demethylases Jmjd3 and UTX in transcriptional regulation.
20442750 2010 Follow-up of potential novel Graves' disease susceptibility loci, identified in the UK WTCCC genome-wide nonsynonymous SNP study.
20123895 2010 The histone demethylase UTX enables RB-dependent cell fate control.
20054297 2010 Systematic sequencing of renal carcinoma reveals inactivation of histone modifying genes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19377476 2009 A systematic, large-scale resequencing screen of X-chromosome coding exons in mental retardation.
19330029 2009 Somatic mutations of the histone H3K27 demethylase gene UTX in human cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18003914 2007 Identification of JmjC domain-containing UTX and JMJD3 as histone H3 lysine 27 demethylases.
17851529 2007 A histone H3 lysine 27 demethylase regulates animal posterior development.
17761849 2007 Demethylation of H3K27 regulates polycomb recruitment and H2A ubiquitination.
17713478 2007 UTX and JMJD3 are histone H3K27 demethylases involved in HOX gene regulation and development.
17500065 2007 PTIP associates with MLL3- and MLL4-containing histone H3 lysine 4 methyltransferase complex.
17178841 2007 Knockdown of ALR (MLL2) reveals ALR target genes and leads to alterations in cell adhesion and growth.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15772651 2005 The DNA sequence of the human X chromosome.
15758204 2005 Positive and negative selection on mammalian Y chromosomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14660691 2004 Sex differences in structure and expression of the sex chromosome genes CHD1Z and CHD1W in zebra finches.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10767340 2000 Deletion and expression analysis of AZFa genes on the human Y chromosome revealed a major role for DBY in male infertility.
9854018 1999 Groucho/transducin-like enhancer of split (TLE) family members interact with the yeast transcriptional co-repressor SSN6 and mammalian SSN6-related proteins: implications for evolutionary conservation of transcription repression mechanisms.
9499428 1998 The UTX gene escapes X inactivation in mice and humans.
9381176 1997 Functional coherence of the human Y chromosome.