Property Summary

NCBI Gene PubMed Count 59
PubMed Score 150.61
PubTator Score 74.03

Knowledge Summary

Patent

No data available

Expression

Gene RIF (51)

PMID Text
26911146 Data show that KDM5B is frequently up-regulated in hepatocellular carcinoma tissues and cell lines and correlated with poor prognosis. Its depletion leads to highly impaired clonogenesis and cell cycle arrest through up-regulation of p15 and p27.
26655717 the presented data suggest a mechanism through which Ikaros and HDAC1 regulate the epigenetic signature in leukemia: via regulation of JARID1B transcription.
26645689 Characterization of a Linked Jumonji Domain of the KDM5/JARID1 Family of Histone H3 Lysine 4 Demethylases.
26621457 KDM5B, a histone demethylase known to be involved in breast cancer tumorigenesis, as a target of miR-137.
26184998 Silencing shJARID1B inhibits migration and invasion of human oral squamous cell carcinoma, reduces cancer stem cell activities and potentiates tumor-inhibiting radiotherapeutic effects.
26125737 The data demonstrated that protein expression of p16 and JARID1B/KDM5B is negatively correlated in invasive ductal carcinoma of the breast.
25951238 provided evidence that JARID1B via modulation of stemness-related signaling is a putative novel therapeutic target for treating malignant NB
25909289 Our results, for the first time, portray a pivotal role of JARID1B in stimulating metastatic behaviors of hepatocellular carcinoma cells
25877751 Our results collectively suggested that JARID1B expressed in lung cancer played a role in lung cancer cells proliferation and invasion, which may be partly associated with the p53 expression
25777981 PLU-1/JARID1B represents a candidate proliferation biomarker for HNSCC diagnosis and treatment.
25755704 This study revealed hyper JARID1B expression and hypo histone H3 lysine 4 tri-methylation in mantle cell lymphoma
25663457 correlation between JARID1B level and chemotherapy resistance was observed in patients with epithelial ovarian cancer (odds ratio (OR) 36.81, 95% CI 4.84-280.11, P < 0.001).
25450384 KDM5B promoted glioma proliferation partly via regulation of the expression of p21.
24952722 Data show that double mutations on the residues in the interface (L325A/D328A) decreases the histone H3 H3K4me2/3 demethylation activity of lysine (K)-specific demethylase 5B (KDM5B).
24937458 Integrated JARID1B chromatin binding, H3K4 methylation, and expression profiles suggest a key function for JARID1B in luminal cell-specific expression programs.
24778210 Our results suggest that KDM5B is a bona fide DNA damage response protein and indicate that KDM5B is an important genome caretaker and a critical regulator of genome stability.
24619877 Study reports that KDM5B (PLU-1/JARID1B), a histone lysine demethylase of Jumonji family, associates with PRC2 and colocalizes with PRC2 in nuclear bodies, and their physical association is dependent on direct interaction between KDM5B and the SUZ12 component of PRC2.
24495580 Our results provide global and functional insight into the role of KDM5B in regulating H3K4 methylation marks near promoters, gene bodies, and enhancers in ES cells and during differentiation.
24481781 Our findings suggest that Myc-mediated transcriptional repression of JARID1B counterintuitively inhibits Myc-regulated cell proliferation and potentially tumorigenesis.
24412361 The first and third, but not the second, PHD fingers of KDM5B possess histone binding activities.
23970103 KDM5B is SUMOylated at lysine residues 242 and 278 and that the ectopic expression of the hPC2 SUMO E3 ligase enhances this SUMOylation.
23759590 A novel role of KDM5B histone lysine demethylase in epithelial-mesenchymal transition, which may contribute to malignant progression of cancer.
23579952 these results indicate that KDM5B represses Cx26 expression in the bladder cancer development.
23408432 analysis of small molecule inhibitors of Jumonji AT-rich interactive domain 1B (JARID1B) histone demethylase by a sensitive high throughput screen
23354547 JARID1B plays a role in colorectal cancer maintenance.
23262439 Contrary to earlier reports, this study shows enhanced expression of JARID1B by melanoma cells and indicates that such an enhancement may be an early event in the disease progression and is not correlated with melanoma invasiveness.
22669717 This study demonstrates that JARID1B is expressed by uveal melanoma cells.
22615382 Jarid1a/b-mediated H3K4 demethylation contributes to silencing of retinoblastoma target genes in senescent cells, suggesting a mechanism by which retinoblastoma triggers gene silencing.
22534467 JARID1B and PHF2 are overexpressed in esophageal squamous cell carcinoma (ESCC) and they may play crucial roles in the course of ESCC initiation and/or progression
22371483 demonstrated that while TFAP2C and Myc can downregulate the CDKN1A promoter independently, KDM5B acts as a corepressor dependent on the other two proteins
22152480 By displacing histone H3K4 demethylase PLU-1, FOXP3 increases both H4K16 acetylation and H3K4 trimethylation at the FOXP3-associated chromatins of multiple FOXP3-activated genes.
21969366 JARID1B demethylase contributes to tumor cell proliferation through the epigenetic repression of a tumor suppressor miR
21937684 JARID1B & LSD1 act in a sequential, coordinated manner to demethylate H3K4. JARID1B represses CCL14 expression, suppressing the angiogenic and metastatic potential of breast cancer cells in vivo.
21821892 crystal of JARID1B belonged to space group P4(3), with unit-cell parameters a = 51.7, b = 51.7, c = 36.2 A
21369698 JARID1B is widely expressed in estrogen receptor+ breast cancers and breast cancer cell lines
21105039 there is a significant increase in the percentage of circulating CD8+ T cells that are specific for two of three investigated JARID1B HLA-A*0201 peptides
20863814 JARID1B is the first TIEG1 corepressor identified, explaining how TIEG1 represses transcription through inducing histone H3 lysine 4 demethylation, which may be important for TIEG1 function in both normal and cancer cells.
20832725 PARP-1 regulates chromatin structure and transcription through a KDM5B-dependent pathway.
20478252 Knockdown of JARID1B leads to an initial acceleration of tumor growth followed by exhaustion which suggests that the JARID1B-positive subpopulation is essential for continuous tumor growth.
20403335 The results from this study demonstrate that the flexible loop L1 of the human JARID1B ARID domain has a crucial role in DNA-binding activity.
20226085 Microarray expression analysis indicated that E2F1 and E2F2 are downstream genes in the KDM5B pathway.
19536175 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of lysine (K)-specific demethylase 5B (KDM5B) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19336002 A phage display screen using the N-terminus of JARID1B as bait identified one of the JARID1B interacting proteins, namely PcG protein (Polycomb group) hPc2.
18048344 JARID1B was identified as a demethylase capable of removing three methyl groups from histone H3 lysine 4 and up-regulated in prostate cancer.
17973255 data support an anti-tumorigenic role of RBP2-H1/JARID1B in melanocytic cells.
17709396 Results identify the target genes regulated by PLU-1/JARID1B, and show that cells overexpressing PLU-1/JARID1B have an impaired G(2)/M checkpoint.
17373667 Results show that both JARID1B and HDAC4 expressed in breast cancers.
17363312 PLU-1-mediated H3K4 demethylase activity plays an important role in the proliferative capacity of breast cancer cells through repression of tumor suppressor genes.
12657635 BF-1 and PAX9 interact with PLU-1 via a novel conserved sequence motif (Ala-X-Ala-Ala-X-Val-Pro-X4-Val-Pro-X8-Pro, termed the VP motif)
12237901 results suggest that the PLU-1 protein may belong to the class of testis/cancer antigens

AA Sequence

MEAATTLHPGPRPALPLGGPGPLGEFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDW      1 - 70
QPPFACDVDKLHFTPRIQRLNELEAQTRVKLNFLDQIAKYWELQGSTLKIPHVERKILDLFQLNKLVAEE     71 - 140
GGFAVVCKDRKWTKIATKMGFAPGKAVGSHIRGHYERILNPYNLFLSGDSLRCLQKPNLTTDTKDKEYKP    141 - 210
HDIPQRQSVQPSETCPPARRAKRMRAEAMNIKIEPEETTEARTHNLRRRMGCPTPKCENEKEMKSSIKQE    211 - 280
PIERKDYIVENEKEKPKSRSKKATNAVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGD    281 - 350
WRCPKCLAQECSKPQEAFGFEQAARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEED    351 - 420
VTVEYGADIASKEFGSGFPVRDGKIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVG    421 - 490
MCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNT    491 - 560
LMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHD    561 - 630
EMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCF    631 - 700
MSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAESYNEWALNVNEALEAKI    701 - 770
NKKKSLVSFKALIEESEMKKFPDNDLLRHLRLVTQDAEKCASVAQQLLNGKRQTRYRSGGGKSQNQLTVN    771 - 840
ELRQFVTQLYALPCVLSQTPLLKDLLNRVEDFQQHSQKLLSEETPSAAELQDLLDVSFEFDVELPQLAEM    841 - 910
RIRLEQARWLEEVQQACLDPSSLTLDDMRRLIDLGVGLAPYSAVEKAMARLQELLTVSEHWDDKAKSLLK    911 - 980
ARPRHSLNSLATAVKEIEEIPAYLPNGAALKDSVQRARDWLQDVEGLQAGGRVPVLDTLIELVTRGRSIP    981 - 1050
VHLNSLPRLETLVAEVQAWKECAVNTFLTENSPYSLLEVLCPRCDIGLLGLKRKQRKLKEPLPNGKKKST   1051 - 1120
KLESLSDLERALTESKETASAMATLGEARLREMEALQSLRLANEGKLLSPLQDVDIKICLCQKAPAAPMI   1121 - 1190
QCELCRDAFHTSCVAVPSISQGLRIWLCPHCRRSEKPPLEKILPLLASLQRIRVRLPEGDALRYMIERTV   1191 - 1260
NWQHRAQQLLSSGNLKFVQDRVGSGLLYSRWQASAGQVSDTNKVSQPPGTTSFSLPDDWDNRTSYLHSPF   1261 - 1330
STGRSCIPLHGVSPEVNELLMEAQLLQVSLPEIQELYQTLLAKPSPAQQTDRSSPVRPSSEKNDCCRGKR   1331 - 1400
DGINSLERKLKRRLEREGLSSERWERVKKMRTPKKKKIKLSHPKDMNNFKLERERSYELVRSAETHSLPS   1401 - 1470
DTSYSEQEDSEDEDAICPAVSCLQPEGDEVDWVQCDGSCNQWFHQVCVGVSPEMAEKEDYICVRCTVKDA   1471 - 1540
PSRK                                                                     1541 - 1544
//

Text Mined References (69)

PMID Year Title
26911146 2016 Depletion of histone demethylase KDM5B inhibits cell proliferation of hepatocellular carcinoma by regulation of cell cycle checkpoint proteins p15 and p27.
26655717 2016 Transcriptional Regulation of JARID1B/KDM5B Histone Demethylase by Ikaros, Histone Deacetylase 1 (HDAC1), and Casein Kinase 2 (CK2) in B-cell Acute Lymphoblastic Leukemia.
26645689 2016 Characterization of a Linked Jumonji Domain of the KDM5/JARID1 Family of Histone H3 Lysine 4 Demethylases.
26621457 2016 MicroRNAs regulate KDM5 histone demethylases in breast cancer cells.
26184998 2015 Silencing JARID1B suppresses oncogenicity, stemness and increases radiation sensitivity in human oral carcinoma.
26125737 2015 Immunohistochemical detection and clinicopathological significance of JARID1B/KDM5B and P16 expression in invasive ductal carcinoma of the breast.
25951238 2015 JARID1B Expression Plays a Critical Role in Chemoresistance and Stem Cell-Like Phenotype of Neuroblastoma Cells.
25909289 2015 JARID1B promotes metastasis and epithelial-mesenchymal transition via PTEN/AKT signaling in hepatocellular carcinoma cells.
25877751 2015 JARID1B modulates lung cancer cell proliferation and invasion by regulating p53 expression.
25777981 2015 PLU-1/JARID1B overexpression predicts proliferation properties in head and neck squamous cell carcinoma.
25755704 2015 JARID1B deletion induced apoptosis in Jeko-1 and HL-60 cell lines.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25663457 2015 Overexpression of JARID1B is associated with poor prognosis and chemotherapy resistance in epithelial ovarian cancer.
25450384 2014 Overexpressed KDM5B is associated with the progression of glioma and promotes glioma cell growth via downregulating p21.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24952722 2014 The PHD1 finger of KDM5B recognizes unmodified H3K4 during the demethylation of histone H3K4me2/3 by KDM5B.
24937458 2014 JARID1B is a luminal lineage-driving oncogene in breast cancer.
24778210 2014 Histone demethylase KDM5B is a key regulator of genome stability.
24619877 2014 Coordinated regulation of retinoic acid signaling pathway by KDM5B and polycomb repressive complex 2.
24495580 2014 KDM5B focuses H3K4 methylation near promoters and enhancers during embryonic stem cell self-renewal and differentiation.
24481781 2014 Histone demethylase JARID1B promotes cell proliferation but is downregulated by N-Myc oncoprotein.
24412361 2014 The histone-H3K4-specific demethylase KDM5B binds to its substrate and product through distinct PHD fingers.
23970103 2013 SUMOylation negatively modulates target gene occupancy of the KDM5B, a histone lysine demethylase.
23759590 2013 KDM5B histone demethylase controls epithelial-mesenchymal transition of cancer cells by regulating the expression of the microRNA-200 family.
23579952 2013 Connexin 26 is down-regulated by KDM5B in the progression of bladder cancer.
23408432 2013 Identification of small molecule inhibitors of Jumonji AT-rich interactive domain 1B (JARID1B) histone demethylase by a sensitive high throughput screen.
23354547 2013 Depletion of JARID1B induces cellular senescence in human colorectal cancer.
23262439 2013 JARID1B expression in human melanoma and benign melanocytic skin lesions.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22669717 2012 JARID1B protein expression and prognostic implications in uveal melanoma.
22615382 2012 H3K4 demethylation by Jarid1a and Jarid1b contributes to retinoblastoma-mediated gene silencing during cellular senescence.
22534467 2013 Overexpression of Jumonji AT-rich interactive domain 1B and PHD finger protein 2 is involved in the progression of esophageal squamous cell carcinoma.
22371483 2012 Histone demethylase KDM5B collaborates with TFAP2C and Myc to repress the cell cycle inhibitor p21(cip) (CDKN1A).
22152480 2011 FOXP3 orchestrates H4K16 acetylation and H3K4 trimethylation for activation of multiple genes by recruiting MOF and causing displacement of PLU-1.
21969366 2011 Jumonji/ARID1 B (JARID1B) protein promotes breast tumor cell cycle progression through epigenetic repression of microRNA let-7e.
21937684 2011 Binding of the JmjC demethylase JARID1B to LSD1/NuRD suppresses angiogenesis and metastasis in breast cancer cells by repressing chemokine CCL14.
21821892 2011 Crystallization and preliminary crystallographic analysis of a PHD domain of human JARID1B.
21369698 2011 PLU-1/JARID1B/KDM5B is required for embryonic survival and contributes to cell proliferation in the mammary gland and in ER+ breast cancer cells.
21105039 2011 T cells reactive with HLA-A*0201 peptides from the histone demethylase JARID1B are found in the circulation of breast cancer patients.
20863814 2010 Histone demethylase JARID1B/KDM5B is a corepressor of TIEG1/KLF10.
20832725 2010 PARP-1 regulates chromatin structure and transcription through a KDM5B-dependent pathway.
20478252 2010 A temporarily distinct subpopulation of slow-cycling melanoma cells is required for continuous tumor growth.
20403335 2010 The flexible loop L1 of the H3K4 demethylase JARID1B ARID domain has a crucial role in DNA-binding activity.
20228790 2010 Phosphorylation of histone H3T6 by PKCbeta(I) controls demethylation at histone H3K4.
20226085 2010 Overexpression of the JmjC histone demethylase KDM5B in human carcinogenesis: involvement in the proliferation of cancer cells through the E2F/RB pathway.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19336002 2009 The PcG protein hPc2 interacts with the N-terminus of histone demethylase JARID1B and acts as a transcriptional co-repressor.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18048344 2007 JARID1B is a histone H3 lysine 4 demethylase up-regulated in prostate cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17973255 2008 RBP2-H1/JARID1B is a transcriptional regulator with a tumor suppressive potential in melanoma cells.
17709396 2007 Functional analysis of the transcription repressor PLU-1/JARID1B.
17373667 2007 Breast cancer associated transcriptional repressor PLU-1/JARID1B interacts directly with histone deacetylases.
17363312 2007 PLU-1 is an H3K4 demethylase involved in transcriptional repression and breast cancer cell proliferation.
17320161 2007 RBP2 belongs to a family of demethylases, specific for tri-and dimethylated lysine 4 on histone 3.
17311883 2007 The Trithorax group protein Lid is a trimethyl histone H3K4 demethylase required for dMyc-induced cell growth.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16645588 2006 Re-expression of the retinoblastoma-binding protein 2-homolog 1 reveals tumor-suppressive functions in highly metastatic melanoma cells.
16541399 2006 Novel JARID1C/SMCX mutations in patients with X-linked mental retardation.
15803180 2005 Retinoblastoma-binding protein 2-homolog 1: a retinoblastoma-binding protein downregulated in malignant melanomas.
15640446 2005 DNA-binding properties of ARID family proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12657635 2003 Human PLU-1 Has transcriptional repression properties and interacts with the developmental transcription factors BF-1 and PAX9.
12237901 2002 PLU-1 nuclear protein, which is upregulated in breast cancer, shows restricted expression in normal human adult tissues: a new cancer/testis antigen?
11483573 2001 Gene targeting of Desrt, a novel ARID class DNA-binding protein, causes growth retardation and abnormal development of reproductive organs.
11478881 2001 Dynamics of the Mrf-2 DNA-binding domain free and in complex with DNA.
10878660 2000 Isolation and chromosomal localization of a new human retinoblastoma binding protein 2 homologue 1a (RBBP2H1A).
10616211 1999 Deficiency of a novel retinoblastoma binding protein 2-homolog is a consistent feature of sporadic human melanoma skin cancer.
10336460 1999 A novel gene (PLU-1) containing highly conserved putative DNA/chromatin binding motifs is specifically up-regulated in breast cancer.