Property Summary

NCBI Gene PubMed Count 47
PubMed Score 43.26
PubTator Score 48.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
medulloblastoma 1524
Disease Target Count P-value
malignant mesothelioma 3163 3.3e-06
ovarian cancer 8491 2.1e-05
psoriasis 6685 3.0e-04
medulloblastoma, large-cell 6234 2.0e-03
glioblastoma 5572 3.3e-03
Disease Target Count Z-score Confidence
Obesity 616 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 3.383 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.100 3.3e-06
psoriasis 1.200 3.0e-04
glioblastoma -1.200 3.3e-03
medulloblastoma, large-cell -1.500 2.0e-03
ovarian cancer -1.400 2.1e-05

Protein-protein Interaction (4)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
720574 screening 140 / 86 / 95401 HTS to Identify Inhibitors of Demethylase GASC-1 Measured in Biochemical System Using Plate Reader - 2043-05_Inhibitor_SinglePoint_HTS_Activity

Gene RIF (25)

PMID Text
26766589 Pharmacological inhibition of KDM4C/PRMT1 suppresses transcription and transformation ability of MLL fusions
26747609 KDM4C recognition of H3K4me3 stimulates demethylation of H3K9me3 in cis on peptide and mononucleosome substrates.
25636512 JMJD2B and JMJD2C play an important role in the pathology of osteosarcoma via the up-regulation of FGF2.
24952432 Data suggest that D396N polymorphism of JmjC domain-containing histone demethylase JMJD2C affects the prognosis of breast cancer by altering caspase-3 cleavage and the ability of double strand DNA break repair which may contribute to therapy resistance.
24371038 GASC1 expression is higher in adenocarcinoma than squamous cell carcinoma. Smoking decreases GASC1 expression in tumor cells, indicating that tobacco smoke may influence the methylation of histone 3 lysine residues in lung cancer.
24285722 KDM4C promotes transcriptional activation by removing the repressive histone mark, H3K9me3, from its target genes. Variation in its expression leads to differences in the growth of normal and some cancer cells.
23698634 KDM4C maintains the sphere-forming capacity in CRCs by mediating the beta-catenin-dependent transcription of JAG1 in a feed-forward manner.
23692052 analysis of the nickel-induced inhibition of truncated constructs of JMJD2A and JMJD2C histone demethylases using X-ray absorption spectroscopy
23148692 Patients with GASC1 positive tumors have better breast cancer specific survival and respond better to radiotherapy and hormonal treatment
23129632 JMJD2C decreases trimethylation of histone H3 at lysine 9, and enhances HIF-1 binding to hypoxia response elements, thereby activating transcription of proteins that are required for metabolic reprogramming and for lung metastasis.
23067339 JMJD2C displays an optimal activity in vitro at alphaKG concentrations similar to those found in cancer cells, with implications for the regulation of histone demethylation activity in cancer versus normal cells.
22072270 This study presented that KDM4C showed strong associations with alcohol withdrawal symptoms (p < 5 x 10-5).
21575637 inhibition measurements showed significant selectivity between KDM4C and KDM6A
20410850 The strongest association in obsessive-compulsive disorder has been found at rs301443 (P=0.000067) residing between SLC1A1 and JMJD2C at 9p24.
20410850 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20127736 identification of genetic alterations & expression changes of LSD1, JHDM2A & GASC1 in prostate cancer (PC); as no genetic alterations & only modest expression changes were found, it is unlikely they play a major role in progression of PC
19784073 GASC1 is a driving oncogene in the 9p23-24 amplicon in human breast cancer.
19339270 Observational study of gene-disease association. (HuGE Navigator)
18927281 Gene rearrangements of JMJD2C is associated with mucosa-associated lymphoid tissue lymphoma.
18713068 Results show that many genes regulated by hypoxia and HIF-1alpha show patterns of induction with JMJD (Jumonji-domain containing)1A and JMJD2B demonstrating robust, and JMJD2C more modest, up-regulation by hypoxia.
18649358 Observational study of gene-disease association. (HuGE Navigator)
17611647 JMJD2C is the histone demethylase implicated in the epigenetic reprogramming during the early embryogenesis.
17277772 JMJD2C and LSD1 interact and both demethylases cooperatively stimulate androgen receptor-dependent gene transcription.
16732293 GASC1 interacts with H3K9me3; three members of this subfamily of proteins demethylate H3K9me3/me2 in vitro through a hydroxylation reaction requiring iron and alpha-ketoglutarate as cofactors

AA Sequence

MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQCYDDIDNLLIP      1 - 70
APIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKYCTPRYLDYEDLERKYWKNLTFVAPIYGADING     71 - 140
SIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKSW    141 - 210
YAIPPEHGKRLERLAQGFFPSSSQGCDAFLRHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAG    211 - 280
FNHGFNCAESTNFATVRWIDYGKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTP    281 - 350
ASTPEVKAWLQRRRKVRKASRSFQCARSTSKRPKADEEEEVSDEVDGAEVPNPDSVTDDLKVSEKSEAAV    351 - 420
KLRNTEASSEEESSASRMQVEQNLSDHIKLSGNSCLSTSVTEDIKTEDDKAYAYRSVPSISSEADDSIPL    421 - 490
SSGYEKPEKSDPSELSWPKSPESCSSVAESNGVLTEGEESDVESHGNGLEPGEIPAVPSGERNSFKVPSI    491 - 560
AEGENKTSKSWRHPLSRPPARSPMTLVKQQAPSDEELPEVLSIEEEVEETESWAKPLIHLWQTKSPNFAA    561 - 630
EQEYNATVARMKPHCAICTLLMPYHKPDSSNEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEY    631 - 700
SPPNAFLEEDGTSLLISCAKCCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKN    701 - 770
NKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYGRCPASFHVTC    771 - 840
AHAAGVLMEPDDWPYVVNITCFRHKVNPNVKSKACEKVISVGQTVITKHRNTRYYSCRVMAVTSQTFYEV    841 - 910
MFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGSNIAHMYQVEFEDGSQIAMKR    911 - 980
EDIYTLDEELPKRVKARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQK    981 - 1050
KCQKRQ                                                                   1051 - 1056
//

Text Mined References (48)

PMID Year Title
26766589 2016 Targeting Aberrant Epigenetic Networks Mediated by PRMT1 and KDM4C in Acute Myeloid Leukemia.
26747609 2016 Opposing Chromatin Signals Direct and Regulate the Activity of Lysine Demethylase 4C (KDM4C).
25636512 2015 Histone demethylase JMJD2B and JMJD2C induce fibroblast growth factor 2: mediated tumorigenesis of osteosarcoma.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25014588 2014 Substrate- and cofactor-independent inhibition of histone demethylase KDM4C.
24952432 2014 A polymorphism in JMJD2C alters the cleavage by caspase-3 and the prognosis of human breast cancer.
24936217 2014 Pro-growth role of the JMJD2C histone demethylase in HCT-116 colon cancer cells and identification of curcuminoids as JMJD2 inhibitors.
24728997 2014 KDM4C (GASC1) lysine demethylase is associated with mitotic chromatin and regulates chromosome segregation during mitosis.
24396064 2014 The demethylase JMJD2C localizes to H3K4me3-positive transcription start sites and is dispensable for embryonic development.
24371038 2014 GASC1 expression in lung carcinoma is associated with smoking and prognosis of squamous cell carcinoma.
24285722 2014 Natural variation in the histone demethylase, KDM4C, influences expression levels of specific genes including those that affect cell growth.
24191012 2013 Inositol pyrophosphates regulate JMJD2C-dependent histone demethylation.
23698634 2013 Histone demethylase KDM4C regulates sphere formation by mediating the cross talk between Wnt and Notch pathways in colonic cancer cells.
23692052 2013 Structural investigations of the nickel-induced inhibition of truncated constructs of the JMJD2 family of histone demethylases using X-ray absorption spectroscopy.
23644528 2013 KDM4/JMJD2 histone demethylases: epigenetic regulators in cancer cells.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23149075 2013 Preliminary evidence of genetic determinants of adiponectin response to fenofibrate in the Genetics of Lipid Lowering Drugs and Diet Network.
23148692 2012 Histone demethylase GASC1--a potential prognostic and predictive marker in invasive breast cancer.
23129632 2012 Histone demethylase JMJD2C is a coactivator for hypoxia-inducible factor 1 that is required for breast cancer progression.
23067339 2012 Kinetic analysis of iron-dependent histone demethylases: ?-ketoglutarate substrate inhibition and potential relevance to the regulation of histone demethylation in cancer cells.
22072270 2012 Genome-wide association study identifies 5q21 and 9p24.1 (KDM4C) loci associated with alcohol withdrawal symptoms.
21914792 2011 Structural and evolutionary basis for the dual substrate selectivity of human KDM4 histone demethylase family.
21637537 2011 Regulation of adipogenesis by nuclear receptor PPAR? is modulated by the histone demethylase JMJD2C.
21575637 2011 Enzyme kinetic studies of histone demethylases KDM4C and KDM6A: towards understanding selectivity of inhibitors targeting oncogenic histone demethylases.
20923822 2010 Radiation pharmacogenomics: a genome-wide association approach to identify radiation response biomarkers using human lymphoblastoid cell lines.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
20410850 2010 Analysis of 9p24 and 11p12-13 regions in autism spectrum disorders: rs1340513 in the JMJD2C gene is associated with ASDs in Finnish sample.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20127736 2010 Genetic alterations and changes in expression of histone demethylases in prostate cancer.
19784073 2009 Genomic amplification and oncogenic properties of the GASC1 histone demethylase gene in breast cancer.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
18927281 2008 Mucosa-associated lymphoid tissue lymphoma: novel translocations including rearrangements of ODZ2, JMJD2C, and CNN3.
18713068 2008 Regulation of Jumonji-domain-containing histone demethylases by hypoxia-inducible factor (HIF)-1alpha.
18649358 2008 Replication of a genome-wide case-control study of esophageal squamous cell carcinoma.
18066052 2008 Phosphorylation of histone H3 at threonine 11 establishes a novel chromatin mark for transcriptional regulation.
17611647 2007 Comparative integromics on JMJD2A, JMJD2B and JMJD2C: preferential expression of JMJD2C in undifferentiated ES cells.
17277772 2007 Cooperative demethylation by JMJD2C and LSD1 promotes androgen receptor-dependent gene expression.
16737911 2006 Molecular cytogenetic characterization of a metastatic lung sarcomatoid carcinoma: 9p23 neocentromere and 9p23-p24 amplification including JAK2 and JMJD2C.
16732293 2006 The putative oncogene GASC1 demethylates tri- and dimethylated lysine 9 on histone H3.
16603238 2006 Reversal of histone lysine trimethylation by the JMJD2 family of histone demethylases.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15138608 2004 Identification and characterization of JMJD2 family genes in silico.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10987278 2000 Identification of a novel gene, GASC1, within an amplicon at 9p23-24 frequently detected in esophageal cancer cell lines.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.