Property Summary

Ligand Count 74
NCBI Gene PubMed Count 54
PubMed Score 46.20
PubTator Score 48.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
medulloblastoma 720 0.0 0.0
Disease Target Count
Alcohol withdrawal syndrome 20
Disease Target Count P-value
malignant mesothelioma 3232 3.3e-06
ovarian cancer 8520 2.1e-05
psoriasis 6694 3.0e-04
medulloblastoma, large-cell 6241 2.0e-03
glioblastoma 5792 3.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Obesity 678 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2499 3.412 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma -1.200 3.3e-03
malignant mesothelioma 1.100 3.3e-06
medulloblastoma, large-cell -1.500 2.0e-03
ovarian cancer -1.400 2.1e-05
psoriasis 1.200 3.0e-04

Gene RIF (26)

AA Sequence

MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQCYDDIDNLLIP      1 - 70
APIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKYCTPRYLDYEDLERKYWKNLTFVAPIYGADING     71 - 140
SIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKSW    141 - 210
YAIPPEHGKRLERLAQGFFPSSSQGCDAFLRHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAG    211 - 280
FNHGFNCAESTNFATVRWIDYGKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTP    281 - 350
ASTPEVKAWLQRRRKVRKASRSFQCARSTSKRPKADEEEEVSDEVDGAEVPNPDSVTDDLKVSEKSEAAV    351 - 420
KLRNTEASSEEESSASRMQVEQNLSDHIKLSGNSCLSTSVTEDIKTEDDKAYAYRSVPSISSEADDSIPL    421 - 490
SSGYEKPEKSDPSELSWPKSPESCSSVAESNGVLTEGEESDVESHGNGLEPGEIPAVPSGERNSFKVPSI    491 - 560
AEGENKTSKSWRHPLSRPPARSPMTLVKQQAPSDEELPEVLSIEEEVEETESWAKPLIHLWQTKSPNFAA    561 - 630
EQEYNATVARMKPHCAICTLLMPYHKPDSSNEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEY    631 - 700
SPPNAFLEEDGTSLLISCAKCCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKN    701 - 770
NKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYGRCPASFHVTC    771 - 840
AHAAGVLMEPDDWPYVVNITCFRHKVNPNVKSKACEKVISVGQTVITKHRNTRYYSCRVMAVTSQTFYEV    841 - 910
MFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGSNIAHMYQVEFEDGSQIAMKR    911 - 980
EDIYTLDEELPKRVKARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQK    981 - 1050
KCQKRQ                                                                   1051 - 1056
//

Text Mined References (55)

PMID Year Title