Property Summary

NCBI Gene PubMed Count 39
PubMed Score 63.50
PubTator Score 45.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
oligodendroglioma 2849 9.3e-16
ovarian cancer 8491 1.0e-05
dermatomyositis 966 1.6e-03
astrocytoma 1493 4.9e-03
Multiple myeloma 1327 1.2e-02
glioblastoma 5572 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Male infertility 170 3.126 1.6
Cancer 2346 3.053 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.472 1.2e-02
astrocytoma 1.600 4.9e-03
glioblastoma 1.200 1.5e-02
oligodendroglioma 1.200 9.3e-16
ovarian cancer 2.200 1.0e-05
dermatomyositis 1.100 1.6e-03

Gene RIF (30)

PMID Text
26728187 These results indicate that the KDM3A-KLF2-IRF4 pathway plays an essential role in multiple myeloma cell survival and homing to the bone marrow, and therefore represents a therapeutic target.
26617828 JMJD1A-MALAT1-MAPK signaling might participate in the JMJD1A-induced cell proliferation of gastric cancer.
25948511 JMJD1A is phosphorylated at S265 by protein kinase A (PKA), and this is pivotal to activate the beta1-adrenergic receptor gene (Adrb1) and downstream targets including Ucp1 in brown adipocytes.
25609425 Loss of JMJD1A expression is associated with liver fibrosis.
25535969 mitogen- and stress-activated protein kinase 1 (MSK1) specifically phosphorylates KDM3A at Ser264 (p-KDM3A), which is enriched in the regulatory regions of gene loci in the human genome.
25148682 ACK1 interacts with KDM3A to regulate the mammary tumor oncogene HOXA1.
25071150 Studies found that JMJD1A was consistently and significantly downregulated at both RNA and protein levels in human germ cell tumors.
24742640 data identify a novel pathway through which N-Myc causes neuroblastoma cell migration and invasion, and provide important evidence for further development of more potent JMJD1A/MALAT1 inhibitors for the prevention of tumor metastasis.
24362521 Studies identify the histone demethylase KDM3A as a new, miR-regulated, tumor promoter in Ewing Sarcoma.
24214985 JMJD1A forms a homodimer through its catalytic domains, bringing the two active sites close together
23891737 Expression of JHDM2A was significantly increased but HDAC2, HDAC7, and SUV39H2 were significantly down-regulated in Systemic Sclerosis B cells relative to controls
23593242 A single amino acid in KDM3A, T667, affects histone demethylase activity towards H3K9me1 and -me2.
23583388 Data indicate that JMJD1A gene silencing abrogated the hypoxia-induced adrenomedullin (ADM) expression and inhibited HepG2 and Hep3B cell growth.
23576503 Our results suggest that LANA may play a role in regulation of epigenetic marks on the KSHV genome, which is in part through association with the histone demethylase KDM3A.
23546878 Exposing cells to either chemical or cellular sources of (*)NO resulted in a significant increase in dimethyl Lys-9 on histone 3 (H3K9me2), the preferred substrate for KDM3A.
22645302 KDM3A is recruited to the SLC2A3 locus in an HIF1-dependent manner and demethylates H3K9me2 so as to upregulate its expression.
22318714 Findings suggest that both Ni(2+) and ascorbate can regulate the expression of histone demethylase JMJD1A, which is important for cancer development or inhibition.
22020899 study demonstrates KDM3A is overexpressed in various types of cancer and directly activates transcription of HOXA1 through demethylation of histone H3K9 by binding to its promoter region
21607773 our results suggest that JMJD1A is a sensitive recurrence marker, and JMJD1A can promote malignant transformation via epithelial-mesenchymal transition.
21541331 Up-regulation of miR-155 in nasopharyngeal carcinoma is partly driven by LMP1 and LMP2A, and results in downregulation of JMJD1A.
21275466 the increased expression of JMJD1A might be associated with the progression of kidney cancer.
20823141 Jumonji domain containing 1A is a novel prognostic marker for colorectal cancer.
20378615 Observational study of gene-disease association. (HuGE Navigator)
20127736 identification of genetic alterations & expression changes of LSD1, JHDM2A & GASC1 in prostate cancer (PC); as no genetic alterations & only modest expression changes were found, it is unlikely they play a major role in progression of PC
20042601 Data show that the JMJD1A/ABH2 family of dioxygenases is highly sensitive to inhibition by carcinogenic nickel ions.
19858293 Hypoxic regulation of JMJD1A acts as a signal amplifier to facilitate hypoxic gene expression, ultimately enhancing tumor growth.
19471969 Immunohistochemical staining has revealed that JMJD1A is widely expressed in tissues, even in cells that are not known to express the androgen receptor, and is significantly increased in smooth muscle cells upon hypoxia treatment.
18984585 histone demethylases JMJD1A and JMJD2B are transcriptional targets of hypoxia-inducible factor HIF
18713068 Results show that many genes regulated by hypoxia and HIF-1alpha show patterns of induction with JMJD (Jumonji-domain containing)1A and JMJD2B demonstrating robust, and JMJD2C more modest, up-regulation by hypoxia.
18538129 These findings demonstrate that JMJD1A can be stimulated by hypoxia both in vitro and in vivo involving binding of HIF-1 to a specific HRE in the JMJD1A promoter.

AA Sequence

MVLTLGESWPVLVGRRFLSLSAADGSDGSHDSWDVERVAEWPWLSGTIRAVSHTDVTKKDLKVCVEFDGE      1 - 70
SWRKRRWIEVYSLLRRAFLVEHNLVLAERKSPEISERIVQWPAITYKPLLDKAGLGSITSVRFLGDQQRV     71 - 140
FLSKDLLKPIQDVNSLRLSLTDNQIVSKEFQALIVKHLDESHLLKGDKNLVGSEVKIYSLDPSTQWFSAT    141 - 210
VINGNPASKTLQVNCEEIPALKIVDPSLIHVEVVHDNLVTCGNSARIGAVKRKSSENNGTLVSKQAKSCS    211 - 280
EASPSMCPVQSVPTTVFKEILLGCTAATPPSKDPRQQSTPQAANSPPNLGAKIPQGCHKQSLPEEISSCL    281 - 350
NTKSEALRTKPDVCKAGLLSKSSQIGTGDLKILTEPKGSCTQPKTNTDQENRLESVPQALTGLPKECLPT    351 - 420
KASSKAELEIANPPELQKHLEHAPSPSDVSNAPEVKAGVNSDSPNNCSGKKVEPSALACRSQNLKESSVK    421 - 490
VDNESCCSRSNNKIQNAPSRKSVLTDPAKLKKLQQSGEAFVQDDSCVNIVAQLPKCRECRLDSLRKDKEQ    491 - 560
QKDSPVFCRFFHFRRLQFNKHGVLRVEGFLTPNKYDNEAIGLWLPLTKNVVGIDLDTAKYILANIGDHFC    561 - 630
QMVISEKEAMSTIEPHRQVAWKRAVKGVREMCDVCDTTIFNLHWVCPRCGFGVCVDCYRMKRKNCQQGAA    631 - 700
YKTFSWLKCVKSQIHEPENLMPTQIIPGKALYDVGDIVHSVRAKWGIKANCPCSNRQFKLFSKPASKEDL    701 - 770
KQTSLAGEKPTLGAVLQQNPSVLEPAAVGGEAASKPAGSMKPACPASTSPLNWLADLTSGNVNKENKEKQ    771 - 840
PTMPILKNEIKCLPPLPPLSKSSTVLHTFNSTILTPVSNNNSGFLRNLLNSSTGKTENGLKNTPKILDDI    841 - 910
FASLVQNKTTSDLSKRPQGLTIKPSILGFDTPHYWLCDNRLLCLQDPNNKSNWNVFRECWKQGQPVMVSG    911 - 980
VHHKLNSELWKPESFRKEFGEQEVDLVNCRTNEIITGATVGDFWDGFEDVPNRLKNEKEPMVLKLKDWPP    981 - 1050
GEDFRDMMPSRFDDLMANIPLPEYTRRDGKLNLASRLPNYFVRPDLGPKMYNAYGLITPEDRKYGTTNLH   1051 - 1120
LDVSDAANVMVYVGIPKGQCEQEEEVLKTIQDGDSDELTIKRFIEGKEKPGALWHIYAAKDTEKIREFLK   1121 - 1190
KVSEEQGQENPADHDPIHDQSWYLDRSLRKRLHQEYGVQGWAIVQFLGDVVFIPAGAPHQVHNLYSCIKV   1191 - 1260
AEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIYHAVKDAVAMLKASESSFGKP            1261 - 1321
//

Text Mined References (46)

PMID Year Title
26728187 2016 The KDM3A-KLF2-IRF4 axis maintains myeloma cell survival.
26617828 2015 Elevated JMJD1A is a novel predictor for prognosis and a potential therapeutic target for gastric cancer.
25948511 2015 JMJD1A is a signal-sensing scaffold that regulates acute chromatin dynamics via SWI/SNF association for thermogenesis.
25609425 2015 Histone H3K9 demethylase JMJD1A modulates hepatic stellate cells activation and liver fibrosis by epigenetically regulating peroxisome proliferator-activated receptor ?.
25535969 2014 Specific phosphorylation of histone demethylase KDM3A determines target gene expression in response to heat shock.
25148682 2014 ACK1 tyrosine kinase interacts with histone demethylase KDM3A to regulate the mammary tumor oncogene HOXA1.
25071150 2014 The hypoxia-inducible epigenetic regulators Jmjd1a and G9a provide a mechanistic link between angiogenesis and tumor growth.
24742640 2014 The histone demethylase JMJD1A induces cell migration and invasion by up-regulating the expression of the long noncoding RNA MALAT1.
24362521 2015 The histone demethylase KDM3A is a microRNA-22-regulated tumor promoter in Ewing Sarcoma.
24214985 2013 Control of histone H3 lysine 9 (H3K9) methylation state via cooperative two-step demethylation by Jumonji domain containing 1A (JMJD1A) homodimer.
23891737 2013 Aberrant histone modification in peripheral blood B cells from patients with systemic sclerosis.
23593242 2013 Protein complex interactor analysis and differential activity of KDM3 subfamily members towards H3K9 methylation.
23583388 2013 The histone demethylase JMJD1A regulates adrenomedullin-mediated cell proliferation in hepatocellular carcinoma under hypoxia.
23576503 2013 Kaposi's sarcoma-associated herpesvirus (KSHV) latency-associated nuclear antigen regulates the KSHV epigenome by association with the histone demethylase KDM3A.
23546878 2013 Nitric oxide modifies global histone methylation by inhibiting Jumonji C domain-containing demethylases.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22645302 2012 Dynamic change of chromatin conformation in response to hypoxia enhances the expression of GLUT3 (SLC2A3) by cooperative interaction of hypoxia-inducible factor 1 and KDM3A.
22318714 2012 Ascorbate antagonizes nickel ion to regulate JMJD1A expression in kidney cancer cells.
22020899 2012 The JmjC domain-containing histone demethylase KDM3A is a positive regulator of the G1/S transition in cancer cells via transcriptional regulation of the HOXA1 gene.
21607773 2012 Role of the hypoxia-related gene, JMJD1A, in hepatocellular carcinoma: clinical impact on recurrence after hepatic resection.
21541331 2011 Upregulation of MiR-155 in nasopharyngeal carcinoma is partly driven by LMP1 and LMP2A and downregulates a negative prognostic marker JMJD1A.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21275466 2011 The expression of histone demethylase JMJD1A in renal cell carcinoma.
20823141 2010 Jumonji domain containing 1A is a novel prognostic marker for colorectal cancer: in vivo identification from hypoxic tumor cells.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
20127736 2010 Genetic alterations and changes in expression of histone demethylases in prostate cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20042601 2010 Nickel ions inhibit histone demethylase JMJD1A and DNA repair enzyme ABH2 by replacing the ferrous iron in the catalytic centers.
19946888 2010 Defining the membrane proteome of NK cells.
19858293 2010 Regulation of the histone demethylase JMJD1A by hypoxia-inducible factor 1 alpha enhances hypoxic gene expression and tumor growth.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19471969 2009 Identification and characterization of demethylase JMJD1A as a gene upregulated in the human cellular response to hypoxia.
18984585 2008 The histone demethylases JMJD1A and JMJD2B are transcriptional targets of hypoxia-inducible factor HIF.
18713068 2008 Regulation of Jumonji-domain-containing histone demethylases by hypoxia-inducible factor (HIF)-1alpha.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18538129 2008 Hypoxia upregulates the histone demethylase JMJD1A via HIF-1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16603237 2006 JHDM2A, a JmjC-containing H3K9 demethylase, facilitates transcription activation by androgen receptor.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.