Property Summary

NCBI Gene PubMed Count 26
PubMed Score 34.49
PubTator Score 22.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Schizophrenia 503
Disease Target Count P-value
osteosarcoma 7933 1.9e-06
group 4 medulloblastoma 1875 5.4e-05
adrenocortical carcinoma 1427 5.1e-04
ovarian cancer 8491 1.5e-03
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0
Disease Target Count Z-score Confidence
WAGR syndrome 12 3.139 1.6
Coloboma 52 3.076 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.295 1.9e-06
group 4 medulloblastoma 1.600 5.4e-05
adrenocortical carcinoma 1.147 5.1e-04
ovarian cancer 1.200 1.5e-03

Gene RIF (15)

PMID Text
26808549 KDM2B is an important mediator of hematopoietic cell development and has opposing roles in tumor progression that are dependent on cellular context.
26004508 The protein lysine demethylases Kdm2a and Kdm2b regulate the turnover of non-phosphorylated beta-catenin specifically within the nucleus via direct interaction with the fourth and fifth armadillo repeats.
25877602 Jhdm1b is a positive regulator of glycolysis, glutaminolysis, and pyrimidine synthesis in HeLa cells.
25273595 Low JHDM1B expression is associated with breast cancers.
25225797 the KDM2B/let-7b/EZH2 axis is involved in epigenetic regulation in MDS, with direct effects on di- and tri-methylation of H3K27.
24853546 NDY1/KDM2B functions as a master regulator of polycomb complexes and controls self-renewal of breast cancer stem cells.
23321669 KDM2B, an H3K36 histone demethylase implicated in bypass of cellular senescence and somatic cell reprogramming, is markedly overexpressed in PDAC, with levels increasing with disease grade and stage, and highest expression in metastases.
23256043 KDM2B specifically recognizes non-methylated DNA in CpG islands and recruits the polycomb repressive complex 1 (PRC1). This contributes to histone H2A lysine 119 ubiquitylation and gene repression.
22825849 a regulatory role of Fbxl10 in cell morphology, chemokine expression, and the metabolic control of fibroblasts.
22086844 It was found that JHDM1B mRNA is predominantly expressed in acute myeloid leukemia-derived aldehyde dehydrogenasehigh/CD34+ cells, and that aberrant expression of JHDM1B induces leukemia cell proliferation through modulation of cell cycle progression.
21252908 A novel functional role for FBXL10 as an anti-apoptotic molecule, and describe a new apoptotic-related pathway that involves NF-jB/FBXL10/c-Fos/ c-FLIP.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17994099 identification of human JHDM1B as a nucleolar protein; JHDM1B preferentially binds the transcribed region of ribosomal DNA to repress the transcription of ribosomal RNA genes
17704768 Results demonstrate that Fbl10 is a key regulator of c-Jun function.
17672918 validated occurrence of an unusual TG 3' splice site in intron 15

AA Sequence

MAGPQMGGSAEDHPPRKRHAAEKQKKKTVIYTKCFEFESATQRPIDRQRYDENEDLSDVEEIVSVRGFSL      1 - 70
EEKLRSQLYQGDFVHAMEGKDFNYEYVQREALRVPLIFREKDGLGIKMPDPDFTVRDVKLLVGSRRLVDV     71 - 140
MDVNTQKGTEMSMSQFVRYYETPEAQRDKLYNVISLEFSHTKLEHLVKRPTVVDLVDWVDNMWPQHLKEK    141 - 210
QTEATNAIAEMKYPKVKKYCLMSVKGCFTDFHIDFGGTSVWYHVFRGGKIFWLIPPTLHNLALYEEWVLS    211 - 280
GKQSDIFLGDRVERCQRIELKQGYTFFIPSGWIHAVYTPVDSLVFGGNILHSFNVPMQLRIYEIEDRTRV    281 - 350
QPKFRYPFYYEMCWYVLERYVYCVTQRSHLTQEYQRESMLIDAPRKPSIDGFSSDSWLEMEEEACDQQPQ    351 - 420
EEEEKDEEGEGRDRAPKPPTDGSTSPTSTPSEDQEALGKKPKAPALRFLKRTLSNESEESVKSTTLAVDY    421 - 490
PKTPTGSPATEVSAKWTHLTEFELKGLKALVEKLESLPENKKCVPEGIEDPQALLEGVKNVLKEHADDDP    491 - 560
SLAITGVPVVTWPKKTPKNRAVGRPKGKLGPASAVKLAANRTTAGARRRRTRCRKCEACLRTECGECHFC    561 - 630
KDMKKFGGPGRMKQSCIMRQCIAPVLPHTAVCLVCGEAGKEDTVEEEEGKFNLMLMECSICNEIIHPGCL    631 - 700
KIKESEGVVNDELPNCWECPKCNHAGKTGKQKRGPGFKYASNLPGSLLKEQKMNRDNKEGQEPAKRRSEC    701 - 770
EEAPRRRSDEHSKKVPPDGLLRRKSDDVHLRKKRKYEKPQELSGRKRASSLQTSPGSSSHLSPRPPLGSS    771 - 840
LSPWWRSSLTYFQQQLKPGKEDKLFRKKRRSWKNAEDRMALANKPLRRFKQEPEDELPEAPPKTRESDHS    841 - 910
RSSSPTAGPSTEGAEGPEEKKKVKMRRKRRLPNKELSRELSKELNHEIQRTENSLANENQQPIKSEPESE    911 - 980
GEEPKRPPGICERPHRFSKGLNGTPRELRHQLGPSLRSPPRVISRPPPSVSPPKCIQMERHVIRPPPISP    981 - 1050
PPDSLPLDDGAAHVMHREVWMAVFSYLSHQDLCVCMRVCRTWNRWCCDKRLWTRIDLNHCKSITPLMLSG   1051 - 1120
IIRRQPVSLDLSWTNISKKQLSWLINRLPGLRDLVLSGCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQ   1121 - 1190
MRDLLSPPTDNRPGQMDNRSKLRNIVELRLAGLDITDASLRLIIRHMPLLSKLHLSYCNHVTDQSINLLT   1191 - 1260
AVGTTTRDSLTEINLSDCNKVTDQCLSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEK   1261 - 1330
LLQKLS                                                                   1331 - 1336
//

Text Mined References (38)

PMID Year Title
26808549 2016 Histone demethylase KDM2B regulates lineage commitment in normal and malignant hematopoiesis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26004508 2015 Kdm2a/b Lysine Demethylases Regulate Canonical Wnt Signaling by Modulating the Stability of Nuclear ?-Catenin.
25877602 2015 A systematic study of the cellular metabolic regulation of Jhdm1b in tumor cells.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25273595 2015 JHDM1B expression regulates ribosome biogenesis and cancer cell growth in a p53 dependent manner.
25225797 2014 The KDM2B- let-7b -EZH2 axis in myelodysplastic syndromes as a target for combined epigenetic therapy.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24853546 2014 NDY1/KDM2B functions as a master regulator of polycomb complexes and controls self-renewal of breast cancer stem cells.
24623842 2014 GABRA1 and STXBP1: novel genetic causes of Dravet syndrome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23321669 2013 KDM2B promotes pancreatic cancer via Polycomb-dependent and -independent transcriptional programs.
23256043 2012 KDM2B links the Polycomb Repressive Complex 1 (PRC1) to recognition of CpG islands.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22825849 2012 The H3K4me3 histone demethylase Fbxl10 is a regulator of chemokine expression, cellular morphology, and the metabolome of fibroblasts.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22086844 2013 JmjC-domain containing histone demethylase 1B-mediated p15(Ink4b) suppression promotes the proliferation of leukemic progenitor cells through modulation of cell cycle progression in acute myeloid leukemia.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21252908 2011 F-box protein 10, an NF-?B-dependent anti-apoptotic protein, regulates TRAIL-induced apoptosis through modulating c-Fos/c-FLIP pathway.
21220025 2011 Fbxl10/Kdm2b deficiency accelerates neural progenitor cell death and leads to exencephaly.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17994099 2007 JHDM1B/FBXL10 is a nucleolar protein that represses transcription of ribosomal RNA genes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17704768 2007 The F-box protein Fbl10 is a novel transcriptional repressor of c-Jun.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
16943429 2006 Polycomb group and SCF ubiquitin ligases are found in a novel BCOR complex that is recruited to BCL6 targets.
16541075 2006 The finished DNA sequence of human chromosome 12.
16362057 2006 Histone demethylation by a family of JmjC domain-containing proteins.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.