Property Summary

Ligand Count 18
NCBI Gene PubMed Count 45
PubMed Score 36.27
PubTator Score 35.57

Knowledge Summary


No data available


  Disease (3)

Disease Target Count Z-score Confidence
Colorectal Neoplasms 243 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0


  Differential Expression (7)

Disease log2 FC p
astrocytoma 1.100 1.1e-02
dermatomyositis 1.400 6.2e-04
juvenile dermatomyositis 1.296 1.7e-13
osteosarcoma 2.964 4.8e-07
ovarian cancer 2.000 1.6e-04
pancreatic ductal adenocarcinoma liver m... 1.131 1.9e-02
psoriasis 1.600 1.9e-04

Gene RIF (24)

AA Sequence

VTLIDLRGCKQITRKACEHFISDLSINSLYCLSDEKLIQKIS                               1121 - 1162

Text Mined References (57)

PMID Year Title