Property Summary

NCBI Gene PubMed Count 15
PubMed Score 24.22
PubTator Score 17.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.180 2.8e-03
atypical teratoid / rhabdoid tumor 1.700 3.0e-04
glioblastoma 1.300 1.3e-02
group 4 medulloblastoma 1.800 5.0e-03
medulloblastoma, large-cell 2.200 6.3e-04
juvenile dermatomyositis 1.264 1.1e-08
acute quadriplegic myopathy 1.503 4.1e-07
tuberculosis 2.700 3.2e-09
Breast cancer 1.900 3.7e-02
aldosterone-producing adenoma -1.085 6.8e-03

 GO Component (2)

Gene RIF (6)

PMID Text
25773598 Histone demethylase LSD2 acts as an E3 ubiquitin ligase and inhibits cancer cell growth through promoting proteasomal degradation of OGT.
25624347 Using transcriptome and chromatin immunoprecipitation-sequencing analyses, the study revealed that LSD2 represses the genes involved in lipid influx and metabolism through demethylation of histone H3K4.
25036127 regulation of tissue factor pathway inhibitor-2 (TFPI-2) expression by lysine-specific demethylase 1 and 2
24924415 These results demonstrate an important role for LSD2 in regulation of DNA methylation and gene silencing in breast cancer.
23266887 The zinc finger-SWIRM-oxidase domains is required for KDM1B demethylase activity and the binding of FAD.
20670891 Human LSD2/KDM1b/AOF1 regulates gene transcription by modulating intragenic H3K4me2 methylation.

AA Sequence

MATPRGRTKKKASFDHSPDSLPLRSSGRQAKKKATETTDEDEDGGSEKKYRKCEKAGCTATCPVCFASAS      1 - 70
ERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYDKYTTWKKIWTSNGKTEPSPKAFMADQQLPYWV     71 - 140
QCTKPECRKWRQLTKEIQLTPQIAKTYRCGMKPNTAIKPETSDHCSLPEDLRVLEVSNHWWYSMLILPPL    141 - 210
LKDSVAAPLLSAYYPDCVGMSPSCTSTNRAAATGNASPGKLEHSKAALSVHVPGMNRYFQPFYQPNECGK    211 - 280
ALCVRPDVMELDELYEFPEYSRDPTMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRCVQEVE    281 - 350
RILYFMTRKGLINTGVLSVGADQYLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGR    351 - 420
VWDDKSFKGVTVGRGAQIVNGCINNPVALMCEQLGISMHKFGERCDLIQEGGRITDPTIDKRMDFHFNAL    421 - 490
LDVVSEWRKDKTQLQDVPLGEKIEEIYKAFIKESGIQFSELEGQVLQFHLSNLEYACGSNLHQVSARSWD    491 - 560
HNEFFAQFAGDHTLLTPGYSVIIEKLAEGLDIQLKSPVQCIDYSGDEVQVTTTDGTGYSAQKVLVTVPLA    561 - 630
LLQKGAIQFNPPLSEKKMKAINSLGAGIIEKIALQFPYRFWDSKVQGADFFGHVPPSASKRGLFAVFYDM    631 - 700
DPQKKHSVLMSVIAGEAVASVRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFV    701 - 770
KTGGSGEAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF                      771 - 822
//

Text Mined References (21)

PMID Year Title
25773598 2015 Histone demethylase LSD2 acts as an E3 ubiquitin ligase and inhibits cancer cell growth through promoting proteasomal degradation of OGT.
25624347 2015 Lysine-specific demethylase 2 suppresses lipid influx and metabolism in hepatic cells.
25036127 2014 Regulation of tissue factor pathway inhibitor-2 (TFPI-2) expression by lysine-specific demethylase 1 and 2 (LSD1 and LSD2).
24924415 2014 Inhibition of histone demethylase, LSD2 (KDM1B), attenuates DNA methylation and increases sensitivity to DNMT inhibitor-induced apoptosis in breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23266887 2013 Structure-function analysis reveals a novel mechanism for regulation of histone demethylase LSD2/AOF1/KDM1b.
23260659 2013 LSD2/KDM1B and its cofactor NPAC/GLYR1 endow a structural and molecular model for regulation of H3K4 demethylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20670891 2010 Human LSD2/KDM1b/AOF1 regulates gene transcription by modulating intragenic H3K4me2 methylation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19727073 2009 KDM1B is a histone H3K4 demethylase required to establish maternal genomic imprints.
19407342 2009 A novel mammalian flavin-dependent histone demethylase.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.