Property Summary

NCBI Gene PubMed Count 16
PubMed Score 27.64
PubTator Score 17.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.503 4.1e-07
aldosterone-producing adenoma -1.085 6.8e-03
atypical teratoid / rhabdoid tumor 1.700 3.0e-04
Breast cancer 1.900 3.7e-02
glioblastoma 1.300 1.3e-02
group 4 medulloblastoma 1.800 5.0e-03
juvenile dermatomyositis 1.264 1.1e-08
medulloblastoma, large-cell 2.200 6.3e-04
osteosarcoma -1.180 2.8e-03
tuberculosis 2.700 3.2e-09

PDB (10)

Gene RIF (7)

AA Sequence

MATPRGRTKKKASFDHSPDSLPLRSSGRQAKKKATETTDEDEDGGSEKKYRKCEKAGCTATCPVCFASAS      1 - 70
ERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYDKYTTWKKIWTSNGKTEPSPKAFMADQQLPYWV     71 - 140
QCTKPECRKWRQLTKEIQLTPQIAKTYRCGMKPNTAIKPETSDHCSLPEDLRVLEVSNHWWYSMLILPPL    141 - 210
LKDSVAAPLLSAYYPDCVGMSPSCTSTNRAAATGNASPGKLEHSKAALSVHVPGMNRYFQPFYQPNECGK    211 - 280
ALCVRPDVMELDELYEFPEYSRDPTMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRCVQEVE    281 - 350
RILYFMTRKGLINTGVLSVGADQYLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGR    351 - 420
VWDDKSFKGVTVGRGAQIVNGCINNPVALMCEQLGISMHKFGERCDLIQEGGRITDPTIDKRMDFHFNAL    421 - 490
LDVVSEWRKDKTQLQDVPLGEKIEEIYKAFIKESGIQFSELEGQVLQFHLSNLEYACGSNLHQVSARSWD    491 - 560
HNEFFAQFAGDHTLLTPGYSVIIEKLAEGLDIQLKSPVQCIDYSGDEVQVTTTDGTGYSAQKVLVTVPLA    561 - 630
LLQKGAIQFNPPLSEKKMKAINSLGAGIIEKIALQFPYRFWDSKVQGADFFGHVPPSASKRGLFAVFYDM    631 - 700
DPQKKHSVLMSVIAGEAVASVRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFV    701 - 770
KTGGSGEAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF                      771 - 822
//

Text Mined References (23)

PMID Year Title