Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.12
PubTator Score 0.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
active Crohn's disease 2.549 3.5e-03
active ulcerative colitis 2.523 4.7e-03
adult high grade glioma 1.700 3.5e-04
atypical teratoid / rhabdoid tumor 2.000 2.4e-03
Barrett's esophagus 1.900 2.5e-02
Breast cancer 1.500 1.3e-05
ependymoma 1.400 1.6e-04
esophageal adenocarcinoma 2.200 1.8e-02
glioblastoma 1.500 3.5e-04
interstitial cystitis 1.500 9.7e-04
intraductal papillary-mucinous adenoma (... 1.800 3.3e-04
intraductal papillary-mucinous carcinoma... 1.600 1.4e-02
intraductal papillary-mucinous neoplasm ... 1.500 9.6e-03
lung adenocarcinoma 1.100 3.2e-09
lung cancer -1.300 1.7e-04
lung carcinoma -1.400 2.4e-14
malignant mesothelioma -2.200 1.8e-08
medulloblastoma, large-cell 1.400 3.3e-04
non primary Sjogren syndrome sicca 1.100 2.5e-02
non-small cell lung cancer 1.599 3.5e-14
osteosarcoma 3.970 1.7e-05
ovarian cancer -1.300 2.8e-03
pituitary cancer -2.900 2.1e-09
psoriasis 1.200 4.4e-03
sonic hedgehog group medulloblastoma 1.600 8.8e-04
spina bifida -1.437 3.7e-02

Protein-protein Interaction (7)

AA Sequence

MNVFRILGDLSHLLAMILLLGKIWRSKCCKGISGKSQILFALVFTTRYLDLFTNFISIYNTVMKVVFLLC      1 - 70
AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILWTFSIYLESVAILPQLFMISK     71 - 140
TGEAETITTHYLFFLGLYRALYLANWIRRYQTENFYDQIAVVSGVVQTIFYCDFFYLYVTKVLKGKKLSL    141 - 210
PMPI                                                                      211 - 214
//

Text Mined References (9)

PMID Year Title