Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.12
PubTator Score 0.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
malignant mesothelioma -3.300 2.0e-08
Barrett's esophagus 1.900 2.5e-02
esophageal adenocarcinoma 2.200 1.8e-02
psoriasis 1.200 4.4e-03
osteosarcoma 5.176 1.9e-06
ependymoma 1.400 1.6e-04
glioblastoma 1.800 3.3e-03
atypical teratoid / rhabdoid tumor 2.000 2.4e-03
medulloblastoma, large-cell 1.400 3.3e-04
non-small cell lung cancer 1.912 6.4e-17
intraductal papillary-mucinous adenoma (... 1.800 3.3e-04
intraductal papillary-mucinous carcinoma... 1.600 1.4e-02
intraductal papillary-mucinous neoplasm ... 1.500 9.6e-03
lung cancer -1.300 1.7e-04
active Crohn's disease 2.549 3.5e-03
active ulcerative colitis 2.523 4.7e-03
interstitial cystitis 1.500 9.7e-04
lung adenocarcinoma 1.515 2.1e-06
adult high grade glioma 1.700 3.5e-04
sonic hedgehog group medulloblastoma 1.600 8.8e-04
non primary Sjogren syndrome sicca 1.100 2.5e-02
Breast cancer 1.500 1.3e-05
lung carcinoma -1.400 2.4e-14
spina bifida -1.437 3.7e-02
ovarian cancer 3.000 2.9e-05
pituitary cancer -2.900 2.1e-09

AA Sequence

MNVFRILGDLSHLLAMILLLGKIWRSKCCKGISGKSQILFALVFTTRYLDLFTNFISIYNTVMKVVFLLC      1 - 70
AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILWTFSIYLESVAILPQLFMISK     71 - 140
TGEAETITTHYLFFLGLYRALYLANWIRRYQTENFYDQIAVVSGVVQTIFYCDFFYLYVTKVLKGKKLSL    141 - 210
PMPI                                                                      211 - 214
//

Text Mined References (9)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.
10591208 1999 The DNA sequence of human chromosome 22.
9118249 1996 The dynamic organisation of the secretory pathway.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.