Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.47
PubTator Score 3.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

 GO Function (1)

Protein-protein Interaction (3)

Gene RIF (2)

AA Sequence

MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKVIYLAC      1 - 70
SYATVYLIYLKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISK     71 - 140
TGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSL    141 - 210
PA                                                                        211 - 212
//

Text Mined References (17)

PMID Year Title