Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.35
PubTator Score 3.30

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

 GWAS Trait (1)

Gene RIF (2)

PMID Text
25682866 A Golgi-based KDELR-dependent signalling pathway controls invadopodia-dependent extracellular matrix degradation.
25569479 Hrr25 protein kinase directly modifies Elp1 on two sites and we provide evidence that phosphorylation plays a positive role in the tRNA modification

AA Sequence

MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKVIYLAC      1 - 70
SYATVYLIYLKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISK     71 - 140
TGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSL    141 - 210
PA                                                                        211 - 212
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25682866 2015 A Golgi-based KDELR-dependent signalling pathway controls extracellular matrix degradation.
25569479 2015 Phosphorylation of Elp1 by Hrr25 is required for elongator-dependent tRNA modification in yeast.
25248455 2015 Exploring the genetics of irritable bowel syndrome: a GWA study in the general population and replication in multinational case-control cohorts.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12071860 2002 Endoplasmic reticulum resident proteins of normal human dermal fibroblasts are the major targets for oxidative stress induced by hydrogen peroxide.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
9118249 1996 The dynamic organisation of the secretory pathway.
1325562 1992 Sequence of a second human KDEL receptor.
1316805 1992 A brefeldin A-like phenotype is induced by the overexpression of a human ERD-2-like protein, ELP-1.