Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.67
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 7.9e-07
posterior fossa group A ependymoma 468 4.9e-06
aldosterone-producing adenoma 665 2.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Restless legs syndrome 27 3.816 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
aldosterone-producing adenoma -1.161 2.7e-02
osteosarcoma 1.244 7.9e-07
posterior fossa group A ependymoma 1.100 4.9e-06

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MEGHKAEEEVLDVLRLNVGGCIYTARRESLCRFKDSMLASMFSGRFPLKTDESGACVIDRDGRLFKYLLD      1 - 70
YLHGEVQIPTDEQTRIALQEEADYFGIPYPYSLSDHLANEMETYSLRSNIELKKALTDFCDSYGLVCNKP     71 - 140
TVWVLHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNNVQYIWSYYSVAELKKM    141 - 210
MDAFDAWEGKGVSYWRVPHELIECWTLEERPLLGSLRHMAPIRKRRLITFNEADESVNYKTGPKPVRFLG    211 - 280
PSTSTQIKVKNSASVTVSPASAIQTSAGATANRFQSGSRRKAAQRSAPSRATALVGTGAPGHPQASPGAA    281 - 350
SAENGGTHLPPAKVLLSDKKPTPQRVIKLKRTPLCATAPCLPSPTATRQANSLKPLPGEAARALGVRTEN    351 - 420
GKNKGN                                                                    421 - 426
//

Text Mined References (6)

PMID Year Title