Property Summary

NCBI Gene PubMed Count 34
PubMed Score 10.62
PubTator Score 7.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 4.200 4.0e-09
medulloblastoma 1.600 2.9e-08
cystic fibrosis 1.400 1.4e-04
tuberculosis and treatment for 3 months 2.300 6.1e-07
X-linked cerebral adrenoleukodystrophy 2.900 1.3e-02
active Crohn's disease -1.500 1.6e-02
adult high grade glioma -1.100 1.7e-03
psoriasis 1.200 1.9e-06
ductal carcinoma in situ 1.800 2.0e-04
invasive ductal carcinoma 1.200 3.7e-02
ovarian cancer 1.800 3.1e-03

Synonym

Accession Q96SI1 A8K600 Q9BVI6
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (21)

PMID Text
25637721 SEC16B, MC4R, MAP2K5 and KCTD15 (rs17782313, rs543874, rs2241423 and rs11084753) polymorphisms are associated with the risk for children obesity in China.
24086424 These data suggest that the non-SUMOylated form of Kctd15 functions in neural crest development.
23382213 results indicate that Kctd15 acts in the embryo at least in part by specifically binding to the activation domain of AP-2alpha, thereby blocking the function of this critical factor in the neural crest induction hierarchy.
23121087 Data show the synthetic effect of SNPs on the indices of adiposity and risk of obesity in Chinese girls, but failed to replicate the effect of five separate variants of SEC16B rs10913469, SH2B1 rs4788102, PCSK1 rs6235, KCTD15 rs29941 and BAT2 rs2844479.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20816152 Observational study of gene-disease association. (HuGE Navigator)
20725061 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20724581 Observational study of gene-disease association. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20520848 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20386550 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20215397 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19910938 Observational study of gene-disease association. (HuGE Navigator)
19910641 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19851340 Observational study of gene-disease association. (HuGE Navigator)
19812171 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19746409 Observational study of gene-disease association. (HuGE Navigator)
19692490 Observational study of gene-disease association. (HuGE Navigator)
19164386 Observational study of gene-disease association. (HuGE Navigator)
19079261 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSS      1 - 70
LATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARY     71 - 140
YQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWN    141 - 210
QDPTHVIRFPLNGYCRLNSVQVLERLFQRGFSVAASCGGGVDSSQFSEYVLCREERRPQPTPTAVRIKQE    211 - 280
PLD                                                                       281 - 283
//

Text Mined References (39)

PMID Year Title
25637721 2015 Genetic variations in SEC16B, MC4R, MAP2K5 and KCTD15 were associated with childhood obesity and interacted with dietary behaviors in Chinese school-age population.
25416956 2014 A proteome-scale map of the human interactome network.
24086424 2013 The BTB-containing protein Kctd15 is SUMOylated in vivo.
23382213 2013 Inhibition of neural crest formation by Kctd15 involves regulation of transcription factor AP-2.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23121087 2013 Sex-dependent associations of genetic variants identified by GWAS with indices of adiposity and obesity risk in a Chinese children population.
21269460 2011 Initial characterization of the human central proteome.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20816152 2010 Obesity and diabetes genetic variants associated with gestational weight gain.
20725061 2011 MC4R variant is associated with BMI but not response to resistance training in young females.
20724581 2010 Genetic susceptibility to obesity and related traits in childhood and adolescence: influence of loci identified by genome-wide association studies.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20520848 2010 Genetic markers of adult obesity risk are associated with greater early infancy weight gain and growth.
20386550 2010 Genes and lifestyle factors in obesity: results from 12,462 subjects from MONICA/KORA.
20215397 2010 Implication of genetic variants near NEGR1, SEC16B, TMEM18, ETV5/DGKG, GNPDA2, LIN7C/BDNF, MTCH2, BCDIN3D/FAIM2, SH2B1, FTO, MC4R, and KCTD15 with obesity and type 2 diabetes in 7705 Chinese.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19910938 2010 Novel obesity risk loci do not determine distribution of body fat depots: a whole-body MRI/MRS study.
19910641 2010 Obesity genotype score and cardiovascular risk in women with type 2 diabetes mellitus.
19851340 2009 Association between obesity and polymorphisms in SEC16B, TMEM18, GNPDA2, BDNF, FAIM2 and MC4R in a Japanese population.
19812171 2010 Cumulative effects and predictive value of common obesity-susceptibility variants identified by genome-wide association studies.
19746409 2010 Are recently identified genetic variants regulating BMI in the general population associated with anorexia nervosa?
19692490 2009 Obesity genes identified in genome-wide association studies are associated with adiposity measures and potentially with nutrient-specific food preference.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19164386 2009 Replication and extension of genome-wide association study results for obesity in 4923 adults from northern Sweden.
19079261 2009 Six new loci associated with body mass index highlight a neuronal influence on body weight regulation.
19079260 2009 Genome-wide association yields new sequence variants at seven loci that associate with measures of obesity.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.