Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active ulcerative colitis 1.115 2.9e-03
adrenocortical carcinoma -1.684 5.3e-03
adult high grade glioma 1.100 1.2e-02
Barrett's esophagus 1.300 4.1e-02
Breast cancer -3.100 3.3e-21
breast carcinoma -1.100 2.6e-17
cutaneous lupus erythematosus 1.100 1.6e-02
esophageal adenocarcinoma 1.300 2.0e-02
intraductal papillary-mucinous adenoma (... 1.100 7.5e-03
intraductal papillary-mucinous neoplasm ... 1.200 1.9e-02
lung cancer -1.300 2.1e-02
medulloblastoma 1.100 8.1e-03
non primary Sjogren syndrome sicca 1.300 1.5e-02
osteosarcoma 1.648 5.5e-06
pancreatic cancer -1.800 1.6e-03
pituitary cancer 1.400 7.4e-03
primary pancreatic ductal adenocarcinoma -1.986 1.5e-03

Synonym

Accession Q9BQ13 B2R9R8
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

AA Sequence

MWQGCAVERPVGRMTSQTPLPQSPRPRRPTMSTVVELNVGGEFHTTTLGTLRKFPGSKLAEMFSSLAKAS      1 - 70
TDAEGRFFIDRPSTYFRPILDYLRTGQVPTQHIPEVYREAQFYEIKPLVKLLEDMPQIFGEQVSRKQFLL     71 - 140
QVPGYSENLELMVRLARAEAITARKSSVLVCLVETEEQDAYYSEVLCFLQDKKMFKSVVKFGPWKAVLDN    141 - 210
SDLMHCLEMDIKAQGYKVFSKFYLTYPTKRNEFHFNIYSFTFTWW                             211 - 255
//

Text Mined References (6)

PMID Year Title