Property Summary

NCBI Gene PubMed Count 20
PubMed Score 8.48
PubTator Score 5.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease -1.100 3.9e-02
Astrocytoma, Pilocytic -1.300 3.4e-07
ependymoma -1.300 1.8e-12
glioblastoma -1.100 1.5e-06
lung carcinoma 1.200 2.2e-22
medulloblastoma, large-cell -1.100 2.7e-03
osteosarcoma -1.856 8.8e-07
Pick disease -1.300 1.9e-04
psoriasis -1.500 5.3e-04
sonic hedgehog group medulloblastoma -1.100 6.5e-04

Gene RIF (5)

AA Sequence

MSAEASGPAAAAAPSLEAPKPSGLEPGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMF      1 - 70
SGRVEVLTDAGGWVLIDRSGRHFGTILNYLRDGSVPLPESTRELGELLGEARYYLVQGLIEDCQLALQQK     71 - 140
RETLSPLCLIPMVTSPREEQQLLASTSKPVVKLLHNRSNNKYSYTSTSDDNLLKNIELFDKLALRFHGRL    141 - 210
LFLKDVLGDEICCWSFYGQGRKIAEVCCTSIVYATEKKQTKVEFPEARIFEETLNILIYETPRGPDPALL    211 - 280
EATGGAAGAGGAGRGEDEENREHRVRRIHVRRHITHDERPHGQQIVFKD                         281 - 329
//

Text Mined References (24)

PMID Year Title