Property Summary

NCBI Gene PubMed Count 19
PubMed Score 24.36
PubTator Score 21.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (34)

Disease log2 FC p
Rheumatoid Arthritis 1.400 1.4e-02
malignant mesothelioma -1.600 3.0e-07
osteosarcoma 1.684 4.9e-04
chronic lymphosyte leukemia -2.100 2.5e-11
cystic fibrosis 1.860 7.7e-04
astrocytoma 1.500 2.1e-02
glioblastoma 1.300 8.7e-03
ulcerative colitis -1.109 1.4e-02
Duchenne muscular dystrophy 2.172 1.2e-05
limb girdle muscular dystrophy 2I 1.275 3.1e-02
juvenile dermatomyositis 1.507 6.0e-06
Amyotrophic Lateral Sclerosis 1.394 2.7e-03
acute quadriplegic myopathy 1.213 4.1e-02
adrenocortical carcinoma -1.061 4.6e-02
chronic kidney disease 1.200 4.8e-02
tuberculosis 1.600 4.9e-05
primary pancreatic ductal adenocarcinoma 1.305 4.2e-03
non-small cell lung cancer -1.532 1.3e-15
intraductal papillary-mucinous adenoma (... -2.500 1.1e-03
lung cancer -3.300 3.0e-05
colon cancer -2.500 4.3e-02
sarcoidosis 1.100 3.6e-03
group 4 medulloblastoma 1.600 1.8e-04
primary Sjogren syndrome 2.100 1.1e-03
aldosterone-producing adenoma -1.301 4.9e-02
lung adenocarcinoma -1.500 1.3e-12
breast carcinoma -1.200 1.3e-26
Pick disease 1.400 8.4e-05
Breast cancer -1.600 5.0e-08
ductal carcinoma in situ -1.100 3.0e-03
invasive ductal carcinoma -1.600 9.4e-05
ovarian cancer 1.800 3.1e-04
Down syndrome 1.300 9.2e-04
pancreatic cancer 1.200 5.8e-03

Synonym

Accession Q96CX2
Symbols PFET1
PFETIN
C13orf2

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (8)

PMID Text
23996491 N-terminal domain of KCTD12 assumes an alpha/beta structure, whereas the C-terminal domain is predominantly characterized by a beta-structure.
23290008 KCTD12 is a useful and reliable biomarker for both the diagnosis and prognosis of gastrointestinal stromal tumor.
20386566 This study provided that kctd12 are associated with Bipolar I in the Han Chinese population.
20386566 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19336475 Observational study of gene-disease association. (HuGE Navigator)
18347171 Pfetin is a powerful prognostic marker for gastrointestinal stromal tumors.
18210030 Observational study of gene-disease association. (HuGE Navigator)
15357420 novel human gene, designated PFET1 (predominantly fetal expressed T1 domain) present in a variety of fetal organs, with highest expression levels in the cochlea and brain

AA Sequence

MALADSTRGLPNGGGGGGGSGSSSSSAEPPLFPDIVELNVGGQVYVTRRCTVVSVPDSLLWRMFTQQQPQ      1 - 70
ELARDSKGRFFLDRDGFLFRYILDYLRDLQLVLPDYFPERSRLQREAEYFELPELVRRLGAPQQPGPGPP     71 - 140
PSRRGVHKEGSLGDELLPLGYSEPEQQEGASAGAPSPTLELASRSPSGGAAGPLLTPSQSLDGSRRSGYI    141 - 210
TIGYRGSYTIGRDAQADAKFRRVARITVCGKTSLAKEVFGDTLNESRDPDRPPERYTSRYYLKFNFLEQA    211 - 280
FDKLSESGFHMVACSSTGTCAFASSTDQSEDKIWTSYTEYVFCRE                             281 - 325
//

Text Mined References (29)

PMID Year Title
25158072 2015 Cross-disorder genome-wide analyses suggest a complex genetic relationship between Tourette's syndrome and OCD.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23996491 2013 A biophysical characterization of the folded domains of KCTD12: insights into interaction with the GABAB2 receptor.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23290008 2013 Use of potassium channel tetramerization domain-containing 12 as a biomarker for diagnosis and prognosis of gastrointestinal stromal tumor.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20400944 2010 Native GABA(B) receptors are heteromultimers with a family of auxiliary subunits.
20386566 2011 Genome-wide association study of bipolar I disorder in the Han Chinese population.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18347171 2008 Pfetin as a prognostic biomarker of gastrointestinal stromal tumors revealed by proteomics.
18210030 2008 Analysis of novel risk loci for type 2 diabetes in a general French population: the D.E.S.I.R. study.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15357420 2004 Isolation from cochlea of a novel human intronless gene with predominant fetal expression.
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8619474 1996 A "double adaptor" method for improved shotgun library construction.