Property Summary

NCBI Gene PubMed Count 19
PubMed Score 8.68
PubTator Score 5.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.100 7.9e-04
osteosarcoma -1.281 5.5e-03
ovarian cancer -1.700 7.4e-06
pancreatic cancer 1.300 1.8e-03
primary pancreatic ductal adenocarcinoma 1.398 9.8e-04

 GO Function (1)

 GWAS Trait (1)

Gene RIF (9)

AA Sequence

MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTLTKQDTMLKAMFSGRMEVLTD      1 - 70
SEGWILIDRCGKHFGTILNYLRDGAVPLPESRREIEELLAEAKYYLVQGLVEECQAALQNKDTYEPFCKV     71 - 140
PVITSSKEEQKLIATSNKPAVKLLYNRSNNKYSYTSNSDDNMLKNIELFDKLSLRFNGRVLFIKDVIGDE    141 - 210
ICCWSFYGQGRKIAEVCCTSIVYATEKKQTKVEFPEARIYEETLNILLYEAQDGRGPDNALLEATGGAAG    211 - 280
RSHHLDEDEERERIERVRRIHIKRPDDRAHLHQ                                         281 - 313
//

Text Mined References (25)

PMID Year Title