Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.37
PubTator Score 5.63

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.281 5.5e-03
primary pancreatic ductal adenocarcinoma 1.398 9.8e-04
group 3 medulloblastoma 1.100 7.9e-04
ovarian cancer -1.700 7.4e-06
pancreatic cancer 1.300 1.8e-03

Gene RIF (8)

PMID Text
23977394 The gastrointestinal stromal tumor-specific transcription factor ETV1 may have no prognostic potential, whereas its downstream gene KCTD10 is associated with a favorable prognosis.
22810651 KCTD10 inhibited the transcriptional activities of nuclear factor kappa B (NF-kappaB) and activating protein-1 reporters
20570916 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19605566 For the SNPs KCTD10_i5642G-->C and MVK_S52NG-->A, homozygotes for the major alleles (G) had lower HDL-cholesterol concentrations than did carriers of the minor alleles (P = 0.005 and P = 0.019, respectively).
19605566 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19154347 binding of SP1 to the proximal promoter region stimulated the promoter activity and endogenous KCTD10 expression, whereas binding of AP-2alpha to this region showed opposite effects.
19125419 KCTD10 may be associated with DNA synthesis and cell proliferation

AA Sequence

MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTLTKQDTMLKAMFSGRMEVLTD      1 - 70
SEGWILIDRCGKHFGTILNYLRDGAVPLPESRREIEELLAEAKYYLVQGLVEECQAALQNKDTYEPFCKV     71 - 140
PVITSSKEEQKLIATSNKPAVKLLYNRSNNKYSYTSNSDDNMLKNIELFDKLSLRFNGRVLFIKDVIGDE    141 - 210
ICCWSFYGQGRKIAEVCCTSIVYATEKKQTKVEFPEARIYEETLNILLYEAQDGRGPDNALLEATGGAAG    211 - 280
RSHHLDEDEERERIERVRRIHIKRPDDRAHLHQ                                         281 - 313
//

Text Mined References (22)

PMID Year Title
23977394 2013 Gene expression network analysis of ETV1 reveals KCTD10 as a novel prognostic biomarker in gastrointestinal stromal tumor.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22810651 2012 TNFAIP1 interacts with KCTD10 to promote the degradation of KCTD10 proteins and inhibit the transcriptional activities of NF-?B and AP-1.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20570916 2010 Fine-mapping in African Americans of 8 recently discovered genetic loci for plasma lipids: the Jackson Heart Study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19782033 2009 Cullin mediates degradation of RhoA through evolutionarily conserved BTB adaptors to control actin cytoskeleton structure and cell movement.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19605566 2009 Novel variants at KCTD10, MVK, and MMAB genes interact with dietary carbohydrates to modulate HDL-cholesterol concentrations in the Genetics of Lipid Lowering Drugs and Diet Network Study.
19154347 2009 Transcription factor specificity protein 1 (SP1) and activating protein 2alpha (AP-2alpha) regulate expression of human KCTD10 gene by binding to proximal region of promoter.
19125419 2009 KCTD10 interacts with proliferating cell nuclear antigen and its down-regulation could inhibit cell proliferation.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18193043 2008 Newly identified loci that influence lipid concentrations and risk of coronary artery disease.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16541075 2006 The finished DNA sequence of human chromosome 12.
15982757 2005 A novel PDIP1-related protein, KCTD10, that interacts with proliferating cell nuclear antigen and DNA polymerase delta.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.