Property Summary

NCBI Gene PubMed Count 14
PubMed Score 162.33
PubTator Score 93.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.800 2.0e-03
ependymoma -1.200 4.3e-02
oligodendroglioma -1.300 1.3e-02
glioblastoma -1.900 5.2e-04
medulloblastoma -1.600 7.9e-05
atypical teratoid / rhabdoid tumor -1.300 7.4e-03
medulloblastoma, large-cell -2.700 3.2e-05
primitive neuroectodermal tumor -1.500 3.1e-03
non-small cell lung cancer 2.133 5.2e-14
intraductal papillary-mucinous adenoma (... 1.600 1.2e-03
interstitial cystitis -1.600 3.5e-05
pediatric high grade glioma -1.600 1.5e-04
pilocytic astrocytoma -1.600 1.1e-07
spina bifida -1.771 4.0e-02
ductal carcinoma in situ 1.200 1.2e-02
ovarian cancer 1.200 2.2e-03

Gene RIF (5)

PMID Text
26334369 The authors find that the KCTD proteins 5, 6, 9 and 17 bind to Cul3 with high affinity, while the KCTD proteins 1 and 16 do not have detectable binding.
24736394 KCTD1 functions as a novel inhibitor of Wnt signaling p
23541344 Mutations in KCTD1 cause scalp-ear-nipple syndrome.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19115315 indicate the novel function of KCTD1 as the transcriptional repressor for AP-2 family, especially for AP-2alpha

AA Sequence

MSRPLITRSPASPLNNQGIPTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDS      1 - 70
LKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPC     71 - 140
ECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERL    141 - 210
QQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLD                           211 - 257
//

Text Mined References (18)

PMID Year Title
26334369 2016 Structural Insights into KCTD Protein Assembly and Cullin3 Recognition.
25416956 2014 A proteome-scale map of the human interactome network.
24736394 2014 KCTD1 suppresses canonical Wnt signaling pathway by enhancing ?-catenin degradation.
23541344 2013 Mutations in KCTD1 cause scalp-ear-nipple syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19115315 2009 The interaction of KCTD1 with transcription factor AP-2alpha inhibits its transactivation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18358072 2008 Characterization and expression of a human KCTD1 gene containing the BTB domain, which mediates transcriptional repression and homomeric interactions.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15561718 2005 Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.