| Tclin | Potassium voltage-gated channel subfamily V member 1 |
Potassium channel subunit that does not form functional channels by itself. Modulates KCNB1 and KCNB2 channel activity by shifting the threshold for inactivation to more negative values and by slowing the rate of inactivation. Can down-regulate the channel activity of KCNB1, KCNB2, KCNC4 and KCND1, possibly by trapping them in intracellular membranes.
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium voltage-gated channel subfamily V. This protein is essentially present in the brain, and its role might be to inhibit the function of a particular class of outward rectifier potassium channel types. [provided by RefSeq, Jul 2008]
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium voltage-gated channel subfamily V. This protein is essentially present in the brain, and its role might be to inhibit the function of a particular class of outward rectifier potassium channel types. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count |
|---|---|
| Eaton-Lambert syndrome | 40 |
| Multiple Sclerosis | 498 |
| Disease | Target Count | P-value |
|---|---|---|
| psoriasis | 6685 | 1.1e-17 |
| atypical teratoid / rhabdoid tumor | 4369 | 1.3e-08 |
| medulloblastoma | 1524 | 6.2e-08 |
| glioblastoma | 5572 | 6.0e-06 |
| primitive neuroectodermal tumor | 3031 | 9.0e-05 |
| malignant mesothelioma | 3163 | 9.4e-05 |
| pilocytic astrocytoma | 3086 | 1.4e-04 |
| astrocytic glioma | 2241 | 4.5e-04 |
| pediatric high grade glioma | 2712 | 4.7e-04 |
| ependymoma | 2514 | 4.9e-04 |
| oligodendroglioma | 2849 | 9.1e-04 |
| medulloblastoma, large-cell | 6234 | 2.2e-03 |
| active ulcerative colitis | 477 | 3.5e-02 |
| Pick disease | 1893 | 3.9e-02 |
| Disease | log2 FC | p |
|---|---|---|
| malignant mesothelioma | 1.300 | 9.4e-05 |
| astrocytic glioma | -2.800 | 4.5e-04 |
| ependymoma | -3.000 | 4.9e-04 |
| oligodendroglioma | -2.800 | 9.1e-04 |
| glioblastoma | -3.700 | 6.0e-06 |
| medulloblastoma | -3.900 | 6.2e-08 |
| atypical teratoid / rhabdoid tumor | -3.700 | 1.3e-08 |
| medulloblastoma, large-cell | -3.700 | 2.2e-03 |
| primitive neuroectodermal tumor | -3.900 | 9.0e-05 |
| active ulcerative colitis | -1.146 | 3.5e-02 |
| pediatric high grade glioma | -2.900 | 4.7e-04 |
| pilocytic astrocytoma | -3.100 | 1.4e-04 |
| Pick disease | -1.200 | 3.9e-02 |
| psoriasis | -2.000 | 1.1e-17 |
MPSSGRALLDSPLDSGSLTSLDSSVFCSEGEGEPLALGDCFTVNVGGSRFVLSQQALSCFPHTRLGKLAV 1 - 70 VVASYRRPGALAAVPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYYRTGRLHVMEQLCALSFLQEIQYW 71 - 140 GIDELSIDSCCRDRYFRRKELSETLDFKKDTEDQESQHESEQDFSQGPCPTVRQKLWNILEKPGSSTAAR 141 - 210 IFGVISIIFVVVSIINMALMSAELSWLDLQLLEILEYVCISWFTGEFVLRFLCVRDRCRFLRKVPNIIDL 211 - 280 LAILPFYITLLVESLSGSQTTQELENVGRIVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLL 281 - 350 LFLSVGISIFSTVEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGILVL 351 - 420 ALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDVYARSIMEMLRLKGRERAST 421 - 490 RSSGGDDFWF 491 - 500 //
| PMID | Year | Title | |
|---|---|---|---|
| 25056061 | 2014 | Biological insights from 108 schizophrenia-associated genetic loci. | |
| 16382104 | 2005 | International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 14697513 | 2004 | Structural characterization and promoter analysis of human potassium channel Kv8.1 (KCNV1) gene. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 12383276 | 2002 | Positional candidate approach for the gene responsible for benign adult familial myoclonic epilepsy. | |
| 9110174 | 1997 | Large-scale concatenation cDNA sequencing. | |
| 9079713 | 1997 | Modes of regulation of shab K+ channel activity by the Kv8.1 subunit. | |
| 8670833 | 1996 | Kv8.1, a new neuronal potassium channel subunit with specific inhibitory properties towards Shab and Shaw channels. | |
| 8619474 | 1996 | A "double adaptor" method for improved shotgun library construction. |
