Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.59
PubTator Score 12.81

Knowledge Summary

Patent (1,576)

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.900 3.3e-05
posterior fossa group B ependymoma -1.400 3.6e-08
cystic fibrosis 1.115 2.2e-04
medulloblastoma, large-cell -1.500 1.8e-03
Duchenne muscular dystrophy -1.213 1.1e-06
autosomal dominant Emery-Dreifuss muscul... -1.138 3.3e-03
acute quadriplegic myopathy -1.029 4.4e-03
lung cancer -3.800 4.3e-05
group 4 medulloblastoma -1.300 4.0e-04
ulcerative colitis 1.600 3.1e-02
ovarian cancer 1.100 5.7e-03

Gene RIF (8)

PMID Text
24170294 By in situ hybridization, KCNS3 mRNA levels were 23% lower in schizophrenia subjects than in controls. At the cellular level, both KCNS3 mRNA-expressing neuron density and KCNS3 mRNA level per neuron were significantly lower.
22943705 study concluded that potassium voltage-gated channel K(V)9.3 is localised to human placental vascular tissues and syncytiotrophoblast
22422395 stromatoxin-1 -sensitive KV2-containing channels are expressed in detrusor smooth muscle (DSM); they control DSM excitability, intracellular Ca2+ levels, and myogenic and nerve-evoked contractions
20876197 There is evidence of heteromultimeric Kv2.1/Kv9.3 channel expression in control of middle cerebral arterial diameter.
18676988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15827117 formation of heteromeric Kv2.1/Kv9.3 channels of fixed stoichiometry consisting of three Kv2.1 subunits and one Kv9.3 subunit
15714333 Observational study of gene-disease association. (HuGE Navigator)
15714333 Our findings suggest that SNPs located at the 3' downstream region of KCNS3 have a significant role in the etiology of AHR.

AA Sequence

MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDYSVADKEYYFD      1 - 70
RNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSNRYQERKEENHEKDWDQKSHDV     71 - 140
STDSSFEESSLFEKELEKFDTLRFGQLRKKIWIRMENPAYCLSAKLIAISSLSVVLASIVAMCVHSMSEF    141 - 210
QNEDGEVDDPVLEGVEIACIAWFTGELAVRLAAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESE    211 - 280
DIENMGKVVQILRLMRIFRILKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDDH    281 - 350
TSSLTSIPICWWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDID    351 - 420
VDQCSEDAPEKCHELPYFNIRDIYAQRMHTFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTA    421 - 490
K//

Text Mined References (18)

PMID Year Title
24170294 2014 Lower gene expression for KCNS3 potassium channel subunit in parvalbumin-containing neurons in the prefrontal cortex in schizophrenia.
22943705 2012 Expression of an electrically silent voltage-gated potassium channel in the human placenta.
22422395 2012 Expression and function of K(V)2-containing channels in human urinary bladder smooth muscle.
20876197 2010 Stromatoxin-sensitive, heteromultimeric Kv2.1/Kv9.3 channels contribute to myogenic control of cerebral arterial diameter.
18676988 2008 A high-density association screen of 155 ion transport genes for involvement with common migraine.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15827117 2005 Fluorescence measurements reveal stoichiometry of K+ channels formed by modulatory and delayed rectifier alpha-subunits.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15714333 2005 Single-nucleotide polymorphisms of the KCNS3 gene are significantly associated with airway hyperresponsiveness.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10484328 1999 Electrically silent potassium channel subunits from human lens epithelium.
9704029 1998 Cloning and tissue distribution of two new potassium channel alpha-subunits from rat brain.
9362476 1997 Kv2.1/Kv9.3, a novel ATP-dependent delayed-rectifier K+ channel in oxygen-sensitive pulmonary artery myocytes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.