Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.62
PubTator Score 6.32

Knowledge Summary

Patent (647)



  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -4.500 2.4e-08
osteosarcoma 1.432 4.9e-04
group 3 medulloblastoma -1.400 4.1e-02
ovarian cancer 1.100 2.2e-09

Gene RIF (5)

24392765 For KCNS1 rs4499491, individuals homozygous for the rare A allele (CC+ CA versus AA) had a 3.0-fold increase in the odds of reporting preoperative breast pain.
24373571 There was moderate statistical evidence for interactions shoulder pain phenotypes between KCNS1 and depressive symptoms, pain catastrophizing, or kinesiophobia
23314412 Several haplotypes of population-specific tagSNPs correlated with pain intensity in black southern African population with HIV-associated sensory neuropathy.
20724292 Thia study presented the KCNS1 allele rs734784 as one of the first prognostic indicators of chronic pain risk.
20724292 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

GVSEASLETSRETSQEGQSADLESQAPSEPPHPQMY                                      491 - 526

Text Mined References (12)

PMID Year Title
24392765 Variations in potassium channel genes are associated with breast pain in women prior to breast cancer surgery.
24373571 2014 Biopsychosocial influence on exercise-induced injury: genetic and psychological combinations are predictive of shoulder pain phenotypes.
23314412 2013 KCNS1, but not GCH1, is associated with pain intensity in a black southern African population with HIV-associated sensory neuropathy: a genetic association study.
22925353 2013 A genome-wide association study of seasonal pattern mania identifies NF1A as a possible susceptibility gene for bipolar disorder.
20724292 2010 Multiple chronic pain states are associated with a common amino acid-changing allele in KCNS1.
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11549316 2001 A high-resolution 6.0-megabase transcript map of the type 2 diabetes susceptibility region on human chromosome 20.
10484328 1999 Electrically silent potassium channel subunits from human lens epithelium.
9305895 1997 New modulatory alpha subunits for mammalian Shab K+ channels.