Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.44
PubTator Score 9.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (6)

AA Sequence

MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIFVDRDGDLFSFILDFLRTHQL      1 - 70
LLPTEFSDYLRLQREALFYELRSLVDLLNPYLLQPRPALVEVHFLSRNTQAFFRVFGSCSKTIEMLTGRI     71 - 140
TVFTEQPSAPTWNGNFFPPQMTLLPLPPQRPSYHDLVFQCGSDSTTDNQTGVRYVSIKPDNRKLANGTNV    141 - 210
LGLLIDTLLKEGFHLVSTRTVSSEDKTECYSFERIKSPEVLITNETPKPETIIIPEQSQIKK            211 - 272
//

Text Mined References (15)

PMID Year Title