Property Summary

Ligand Count 19
NCBI Gene PubMed Count 126
PubMed Score 448.81
PubTator Score 255.79

Knowledge Summary

Patent (27,028)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Benign neonatal seizures 4 0.0 5.0

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -3.100 1.4e-05
astrocytic glioma -1.500 3.5e-03
Astrocytoma, Pilocytic -2.100 6.3e-07
atypical teratoid / rhabdoid tumor -5.100 2.2e-09
ependymoma -3.100 2.1e-02
glioblastoma -2.900 9.1e-07
group 3 medulloblastoma -2.900 1.9e-03
malignant mesothelioma 2.900 3.4e-06
medulloblastoma, large-cell -3.100 6.2e-04
oligodendroglioma 1.700 3.8e-03
Pick disease -1.500 4.1e-02
primitive neuroectodermal tumor -1.600 2.8e-04
subependymal giant cell astrocytoma -3.562 4.1e-02

Gene RIF (93)

AA Sequence

MVQKSRNGGVYPGPSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSILSKPRAGGAGAGKPPKR      1 - 70
NAFYRKLQNFLYNVLERPRGWAFIYHAYVFLLVFSCLVLSVFSTIKEYEKSSEGALYILEIVTIVVFGVE     71 - 140
YFVRIWAAGCCCRYRGWRGRLKFARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIR    141 - 210
MDRRGGTWKLLGSVVYAHSKELVTAWYIGFLCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGY    211 - 280
GDKYPQTWNGRLLAATFTLIGVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGLIQSAWRFYATN    281 - 350
LSRTDLHSTWQYYERTVTVPMYSSQTQTYGASRLIPPLNQLELLRNLKSKSGLAFRKDPPPEPSPSKGSP    351 - 420
CRGPLCGCCPGRSSQKVSLKDRVFSSPRGVAAKGKGSPQAQTVRRSPSADQSLEDSPSKVPKSWSFGDRS    421 - 490
RARQAFRIKGAASRQNSEEASLPGEDIVDDKSCPCEFVTEDLTPGLKVSIRAVCVMRFLVSKRKFKESLR    491 - 560
PYDVMDVIEQYSAGHLDMLSRIKSLQSRVDQIVGRGPAITDKDRTKGPAEAELPEDPSMMGRLGKVEKQV    561 - 630
LSMEKKLDFLVNIYMQRMGIPPTETEAYFGAKEPEPAPPYHSPEDSREHVDRHGCIVKIVRSSSSTGQKN    631 - 700
FSAPPAAPPVQCPPSTSWQPQSHPRQGHGTSPVGDHGSLVRIPPPPAHERSLSAYGGGNRASMEFLRQED    701 - 770
TPGCRPPEGNLRDSDTSISIPSVDHEELERSFSGFSISQSKENLDALNSCYAAVAPCAKVRPYIAEGESD    771 - 840
TDSDLCTPCGPPPRSATGEGPFGDVGWAGPRK                                          841 - 872
//

Text Mined References (130)

PMID Year Title