Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 3.0e-06
Disease Target Count Z-score Confidence
Gingival fibromatosis 14 4.11 2.1

Synonym

Accession Q9H478
Symbols BWRT
HSA404617

Gene

 Compartment GO Term (1)

 GWAS Trait (1)

AA Sequence

MGRKWSGPTAEHQLPMPPPGVRLDSWKGVASGCSPSKASQEARGKEKCPTLNGQPQWSALFTLPPQRE        1 - 68
//

Text Mined References (6)

PMID Year Title