Property Summary

NCBI Gene PubMed Count 110
PubMed Score 284.04
PubTator Score 272.23

Knowledge Summary

Patent (12,038)

Expression

Gene RIF (98)

PMID Text
27092946 KCa3.1 and CFTR colocalize at the plasma membrane.
26824610 KCNN4 inhibition differentially regulates migration of intestinal epithelial cells in inflamed vs. non-inflamed conditions in a PI3K/Akt-mediated manner.
26689552 KCa3.1 protein expression was increased in asthmatic compared to healthy airway epithelium in situ, and KCa3.1 currents were larger in asthmatic compared to healthy HBECs cultured in vitro
26418693 Data show that calcium-dependent potassium channel KCa3.1 operates as a positive feedback mechanism for intracellular Ca2+ increase.
26198474 describes patients from 2 well-phenotyped hereditary xerocytosis (HX) kindreds, including from one of the first HX kindreds described, who lack predicted heterozygous PIEZO1-linked variants
26178367 Novel Gardos channel mutations linked to dehydrated hereditary stomatocytosis (xerocytosis).
26177720 KCa3.1 activation in human lung mast cells is highly dependent on Ca(2+) influx through Orai1 channels, mediated via a close spatiotemporal interaction between the two channels.
26148990 identification of a dominantly inherited missense mutation in the Gardos channel in 2 unrelated families and its association with chronic hemolysis and dehydrated cells, also referred to as hereditary xerocytosis
26138196 that KCa3.1 channels are key actors in the migration capacity of neutrophils, and its inhibition did not affect other relevant cellular functions
25848765 high KCa3.1-mRNA expression levels were indicative of low disease specific survival of ccRCC patients, short progression-free survival, and a high metastatic potential. Therefore, KCa3.1 is of prognostic value in ccRCC
25545021 The present study shows that KCNN4 is expressed at the mRNA and protein level in RA-SFs, is functionally active, and has a regulatory impact on cell proliferation and secretion of pro-inflammatory and pro-destructive mediators.
25477223 Blood brain barrier endothelial cells exhibit KCa3.1 protein and activity.
25476248 Ca2+- and KCa3.1-dependent processes facilitate "constitutive" alpha smooth muscle actin expression and Smad2/3 signalling in IPF-derived fibroblasts, and thus promote fibroblast to myofibroblast differentiation.
25415613 The role and mechanisms of KCa3.1 in progressive diabetic chronic kidney disease are reviewed.
25372486 Inhibition of K(Ca)3.1 by EETs (14,15-EET), 20-HETE, and omega3 critically depended on the presence of electron double bonds and hydrophobicity within the 10 carbons preceding the carboxyl-head of the molecules.
25300013 the inhibition of two K(+) channel isoforms, Kv1.2 and KCa3.1, by two drug molecules, lidocaine and TRAM-34, is examined in atomic detail using molecular dynamics simulations.
24963668 KCa3.1 has a role in diabetic nephropathy. (review)
24885636 Tumor-associated macrophages participate in the metastasis of CRC induced by PRL-3 through secretion of IL-6 and IL-8 in a KCNN4 dependent manner.
24826782 These data suggest that NO activates KCNN4 channels through the PKG but not the PKA pathways.
24733189 Overexpression of CCL20 in human proximal tubular cells is inhibited by blockade of KCa3.1 under diabetic conditions through inhibition of the NF-kappaB pathway.
24585442 KCa3.1 confers an invasive phenotype that significantly worsens a patient's outlook with malignant glioma.
24470490 The channel gating process for KCa3.1 and the S5 transmembrane segment is controlled by aromatic-aromatic interactions involving the pore helix.
24392001 KCa3.1 pharmacological blockade attenuated human myofibroblast proliferation, wound healing, collagen secretion and contractility in vitro, and this was associated with inhibition of TGFbeta1-dependent increases in intracellular free Ca2+.
24312257 Our findings suggest that KCa3.1 channels play an important role in the pathogenesis of chronic AV and constitute an attractive target for the prevention of arteriopathy.
24227782 Adenosine inhibits KCa3.1 in human T cells via A2A receptor & PKAI. Comparable effects were obtained by KCa3.1 blockade with TRAM-34. Adenosine suppresses IL-2 secretion via KCa3.1 inhibition.
24193405 Mg(2+) inhibits KCa3.1 via a rapid, voltage-dependent mechanism that leads to a reduction of the channel's unitary current and by reducing the open probability of the channel
24166472 blockade of KCa3.1 attenuates diabetic renal interstitial fibrogenesis through inhibiting activation of fibroblasts
24158513 Globotriaosylceramide accelerates the endocytosis and lysosomal degradation of endothelial KCa3.1 via a clathrin-dependent process, leading to endothelial dysfunction in Fabry disease.
24146918 blocking KCa3.1 increases the degranulation and cytotoxicity of adherent Natural killer cells, but not of non-adherent-Natural killer cells.
24138859 This study provides insight into the key molecular determinants for the high-affinity binding of peptide toxins to KCa3.1.
24055799 These findings highlight a novel role for the KCa3.1 channel in human BSM cell phenotypic modulation.
23949222 KCa3.1 activity has an important role in glioblastoma invasiveness.
23904164 KCa3.1 channels contribute to the regulation of glucocorticosteroid-resistant inflammatory pathways in airway smooth musclecells
23792675 CaMKK/Akt/p300 cascade plays an important role in laminar stress-dependent induction of KCa2.3 and KCa3.1 expression, thereby regulating EC function and adaptation to hemodynamic changes.
23720748 Data indicate that Epac1-Rap1A-RhoA-ROCK signaling affects Cl- secretion via effects on the apical expression of KCNN4c channels.
23609438 KCa3.1 plays an important role in VSMC proliferation via controlling Ca(2+)-dependent signaling pathways
23589888 A previously unrecognized Ca(2+)-activated intermediate K(+) conductance (IK(Ca), KCa3.1, or SK4) in young and old stage-derived human embryonic stem cell-derived cardiomyocytes, was identified.
23572150 Explored the mechanism by which PRL-3 mediates EMT. Demonstrated that PRL-3 induced the expression of KCNN4 channels, leading to EMT and the down-regulation of E-cadherin.
23407879 KCa3.1 in HEL cells displays a unique form of voltage dependence modulating open channel probability.
23392713 Our results suggested that IKCa1 may play a role in the proliferation of human HCC, and IKCa1 blockers may represent a potential therapeutic strategy for HCC.
23345219 K(Ca)3.1 and ClC-3 are expressed in tissue samples obtained from patients diagnosed with grade IV gliomas. Both K(Ca)3.1 and ClC-3 colocalize to the invading processes of glioma cells
23261940 results provide evidence plasma from preeclampsia generates superoxide via a LOX1-NOX2-mediated pathway and downregulates endothelial KCa3.1, which may contribute to endothelial dysfunction and vasculopathy in preeclampsia
21872912 The K(+) channel K(Ca)3.1 plays a key role in human fibrocyte migration
21725609 PRL-3 promoted the proliferation of LoVo cells through upregulation of KCNN4 channels which facilitated the G2/M transition.
21551009 hypoxic exercise training this intervention depresses Gardos channel-modulated erythrocyte rheological functions
21465474 This study focussed on the endocytic internalization and the intracellular transport of the human isoform hK(Ca)3.1.
21345794 the N-terminal domain of K(Ca)3.1 is critical for channel trafficking to the plasma membrane
21228320 Results are consistent with the notion that human K(Ca)3.1 channels are assembled from two homomeric dimers and not randomly from four independent subunits.
21172909 Intermediate conductance calcium-activated potassium channel mediates vasodilation together with nitric oxide and connexin 37 in mesenteric artery.
21123738 Data suggest that human IK1-induced cell proliferation occurs by a direct interaction with ERK1/2 and JNK signaling pathways.
20808839 Ca(2+)-activated K(+) channels do not play a critical role in proliferation of glioma cells
20720181 These results are the first to demonstrate that plasma membrane-associated KCa3.1 is targeted for lysosomal degradation via a Rab7 and ESCRT-dependent pathway.
20712009 hKCa3.1 might contribute to breast tumour-progression and can serve as a useful prognostic marker for breast cancer.
20501432 IK1 channels are present in biliary epithelial cells and contribute to ATP-stimulated secretion through a P2Y-IP3 receptor pathway.
20407432 Our data implicate the role of KCNN4 in ileal Crohn Disease.
20407432 Observational study of gene-disease association. (HuGE Navigator)
20036632 presence of mtKCa3.1 in tumor cell lines using biochemical and electrophysiological approaches
19823864 Data demonstrate that bestrophin 1 is localized in the endoplasmic reticulum (ER), where it interacts with the ER-Ca(2+) sensor and can enhance Ca(2+) signaling and activation of Ca(2+)-dependent Cl(-) (TMEM16A) and K(+) (SK4) channels.
19644414 The aim of this study was to investigate the relationship between single-nucleotide polymorphisms (SNPs) in the human KCNN4 gene or haplotypes and the incidence of myocardial infarction or cerebral infarction in Japanese.
19644414 Observational study of gene-disease association. (HuGE Navigator)
19608980 Nitric oxide increases cardiac IK1 by nitrosylation of cysteine 76 of Kir2.1 channels.
19587117 Data show that the class II phosphatidylinositol 3 kinase C2beta (PI3K-C2beta) is activated by the T-cell receptor (TCR) and functions upstream of NDPK-B to activate KCa3.1 channel activity.
19409928 The expression level of K(Ca)3.1 channels was similar in all T cell subsets in multiple sclerosis patients.
19406468 Data show that moderate increases of mitochondrial matrix [Ca(2+)] will cause mtK(Ca)3.1 opening, thus linking inner membrane K(+) permeability and transmembrane potential to Ca(2+) signalling.
19270724 overexpression of the IK(Ca1) channel is likely to promote carcinogenesis in human prostate tissue.
19052260 Inhibition of the KCa3.1 channels by AMP-activated protein kinase in human airway epithelial cells.
18796614 the mammalian protein histidine phosphatase (PHPT-1) directly binds and inhibits KCa3.1 by dephosphorylating histidine 358 on KCa3.1
18792407 findings show the G(s)-coupled EP(2) receptor closes K(Ca)3.1 in lung mast cells and attenuates both chemokine- and PGE(2)-dependent lung mast cell migration
18690018 An NH2-terminal multi-basic RKR motif is required for the ATP-dependent regulation of IK1.
18688283 KCa3.1 contributes to atherogenesis in mice and humans
18547995 KCa3.1 channels play a critical role in transcellular chloride secretion and net fluid transport into the kidney cysts of patients with ADPKD by maintaining
18367588 IK1 channel activity appears to mediate, at least in part, the response of epidermoid cancer cells to cisplatin treatment.
18287336 KCa3.1 channels are not immobilized at the front but move in a diffuse way throughout the plasma membrane of migrating cells.
18227067 KCa3.1 and KCa2.3 are translocated out of the endoplasmic reticulum associated with Derlin-1.
18184876 KCNN4 channels, possibly in parallel with volume-sensitive outwardly rectifying Cl channels, effect regulatory volume decrease in lens epithelial cells.
17762175 SK4 channels activity, underlying the Ca(2+)-dependent K(+) permeability was in particular increased by IL-13
17585114 KCa3.1 channels are important in human airway smooth muscle cell proliferation.
17474152 The G(alphas)-coupled adenosine A2A receptor closes KCa3.1, providing a clearly defined mechanism by which adenosine inhibits human lung mast cell migration and degranulation.
17470662 KCNN4 activity decines sharply throughout the lifespan of human red blood cells.
17353352 S6 transmembrane segment of the open KCa3.1 channel contains two functional domains delimited by V282 with MTSEA and MTSET binding leading to a channel inhibition at V275, T278, and V282 and to a steep channel activation at positions A283 and A286
17310992 Increased activity of IKCa1 channel is necessary for the development of endometrial cancer.
17157250 We show that nucleoside diphosphate kinase B (NDPK-B), a mammalian histidine kinase, functions downstream of PI(3)P to activate KCa3.1 by phosphorylating histidine 358 in the carboxyl terminus of KCa3.1.
17151145 KCa3.1 channels are a part of the signaling complex that forms at the IS upon antigen presentation.
16766578 H441 cells express KCNN4 and cellular potassium conductance is important to the control of Na(+) absorption in respiratory epithelium
16251351 phosphatidylinositol 3-phosphate and these 14 amino acids regulate KCa3.1 channel activity by recruiting an as yet to be defined regulatory subunit that is required for Ca2+ gating of KCa3.1
15965951 Results describe the subcellular distribution of the canine (cIK1) and the human (hIK1) channel protein in different migrating cells.
15817638 first demonstration that gating of the iKCa1 potassium channel is regulated by beta2-adrenoceptors
15452196 We present in this work a structural model of the open IKCa (KCa3.1) channel derived by homology modeling from the MthK channel structure, and used this model to compute the transmembrane potential profile along the channel pore.
15339840 stochastic Ca2+ permeabilization rather than Gardos-channel variation is the main determinant selecting which sickle cells dehydrate through Gardos channels in each sickling episode
15039018 activation of Gardos channel at different oxygen tensions is correlated with changes in passive and active calcium transport and sensitivity to calcium
14754884 the NH(2) terminus of hIK1 contains overlapping leucine zipper and dileucine motifs essential for channel assembly and trafficking to the plasma membrane
14724753 K(Ca) channels presenting the pharmacology of SK4 channels are present on both apical and basolateral membranes, but it is the basolateral SK4-like channels that play a major role in calcium-dependent chloride secretion in 16HBE14o- cells.
12773623 SK4 is the gene that codes for the Gardos channel in red blood cells. This channel is important pathophysiologically, because it represents the major pathway for cell shrinkage via KCl and water loss that occurs in sickle cell disease.
12612194 Ca2+-activated Cl- secretion in native human airway epithelia requires activation of Ca2+-dependent basolateral K+ channels (hSK4).
12609997 arachidonic acid (AA) interacts with the pore-lining amino acids, Thr(250) and Val(275) in hIK1, conferring inhibition of hIK1 by AA
12493744 trafficking depends upon a C-terminal leucine zipper
12421833 functional role of the intermediate conductance Ca(2+)-activated K(+) channel, hIK1, in HaCaT keratinocytes
10758170 HIV-1 gp120 from both CCR5- and CXCR4-tropic HIV-1 strains opens calcium-activated potassium (K(Ca)), chloride, and calcium-permeant nonselective cation channels in macrophages; these signals are mediated by CCR5 and CXCR4

AA Sequence

MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFLVKCTISISTF      1 - 70
LLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPAPVRGPPCVQDLGAPLTSPQP     71 - 140
WPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYRSIGALNQVRFRHWFVAKLYMNTHPGRLLLG    141 - 210
LTLGLWLTTAWVLSVAERQAVNATGHLSDTLWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTAL    211 - 280
LVAVVARKLEFNKAEKHVHNFMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINA    281 - 350
FRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLP    351 - 420
EPSQQSK                                                                   421 - 427
//

Text Mined References (112)

PMID Year Title
27092946 2016 Investigating CFTR and KCa3.1 Protein/Protein Interactions.
26824610 2016 K+ Channel Inhibition Differentially Regulates Migration of Intestinal Epithelial Cells in Inflamed vs. Non-Inflamed Conditions in a PI3K/Akt-Mediated Manner.
26689552 2015 KCa3.1 K+ Channel Expression and Function in Human Bronchial Epithelial Cells.
26418693 2015 KCa3.1-Dependent Hyperpolarization Enhances Intracellular Ca2+ Signaling Induced by fMLF in Differentiated U937 Cells.
26198474 2015 Mutations in the Gardos channel (KCNN4) are associated with hereditary xerocytosis.
26178367 2015 Novel Gardos channel mutations linked to dehydrated hereditary stomatocytosis (xerocytosis).
26177720 2015 Orai/CRACM1 and KCa3.1 ion channels interact in the human lung mast cell plasma membrane.
26148990 2015 A mutation in the Gardos channel is associated with hereditary xerocytosis.
26138196 2016 The calcium-activated potassium channel KCa3.1 plays a central role in the chemotactic response of mammalian neutrophils.
25848765 2015 High expression of KCa3.1 in patients with clear cell renal carcinoma predicts high metastatic risk and poor survival.
25545021 2015 Functional role of the KCa3.1 potassium channel in synovial fibroblasts from rheumatoid arthritis patients.
25477223 2015 Blood-brain barrier KCa3.1 channels: evidence for a role in brain Na uptake and edema in ischemic stroke.
25476248 2014 Increased constitutive ?SMA and Smad2/3 expression in idiopathic pulmonary fibrosis myofibroblasts is KCa3.1-dependent.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25415613 2015 KCa3.1: a new player in progressive kidney disease.
25372486 2014 Modulation of K(Ca)3.1 channels by eicosanoids, omega-3 fatty acids, and molecular determinants.
25300013 2014 Mechanisms and energetics of potassium channel block by local anesthetics and antifungal agents.
24963668 2014 Role of the potassium channel KCa3.1 in diabetic nephropathy.
24885636 2014 Tumor-associated macrophage-derived IL-6 and IL-8 enhance invasive activity of LoVo cells induced by PRL-3 in a KCNN4 channel-dependent manner.
24826782 2014 The stimulating effects of nitric oxide on intermediate conductance Ca²?-activated K? channels in human dermal fibroblasts through PKG pathways but not the PKA pathways.
24733189 2014 High glucose induces CCL20 in proximal tubular cells via activation of the KCa3.1 channel.
24585442 2014 A proinvasive role for the Ca(2+) -activated K(+) channel KCa3.1 in malignant glioma.
24470490 2014 Aromatic-aromatic interactions between residues in KCa3.1 pore helix and S5 transmembrane segment control the channel gating process.
24392001 2013 The K+ channel KCa3.1 as a novel target for idiopathic pulmonary fibrosis.
24312257 2013 The Ca²?-activated K? channel KCa3.1 as a potential new target for the prevention of allograft vasculopathy.
24227782 2013 Selective inhibition of KCa3.1 channels mediates adenosine regulation of the motility of human T cells.
24193405 2014 Mg²? modulation of the single-channel properties of KCa3.1 in human erythroleukemia cells.
24166472 2014 KCa3.1 mediates activation of fibroblasts in diabetic renal interstitial fibrosis.
24158513 2014 Globotriaosylceramide induces lysosomal degradation of endothelial KCa3.1 in fabry disease.
24146918 2013 Blocking KCa3.1 channels increases tumor cell killing by a subpopulation of human natural killer lymphocytes.
24138859 2013 Molecular dynamics simulations of scorpion toxin recognition by the Ca(2+)-activated potassium channel KCa3.1.
24055799 2013 Up-regulation of KCa3.1 promotes human airway smooth muscle cell phenotypic modulation.
23949222 2013 KCa3.1 channels are involved in the infiltrative behavior of glioblastoma in vivo.
23904164 2013 Functional KCa3.1 channels regulate steroid insensitivity in bronchial smooth muscle cells.
23792675 2013 Laminar shear stress upregulates endothelial Ca²?-activated K? channels KCa2.3 and KCa3.1 via a Ca²?/calmodulin-dependent protein kinase kinase/Akt/p300 cascade.
23720748 2013 The Epac1 signaling pathway regulates Cl- secretion via modulation of apical KCNN4c channels in diarrhea.
23609438 2013 The intermediate conductance calcium-activated potassium channel KCa3.1 regulates vascular smooth muscle cell proliferation via controlling calcium-dependent signaling.
23589888 2013 SK4 Ca2+ activated K+ channel is a critical player in cardiac pacemaker derived from human embryonic stem cells.
23572150 2013 KCNN4 channels participate in the EMT induced by PRL-3 in colorectal cancer.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23407879 2013 Voltage dependence of the Ca(2+)-activated K(+) channel K(Ca)3.1 in human erythroleukemia cells.
23392713 2013 Inhibitory effects of blockage of intermediate conductance Ca(2+)-activated K (+) channels on proliferation of hepatocellular carcinoma cells.
23345219 2013 Bradykinin-induced chemotaxis of human gliomas requires the activation of KCa3.1 and ClC-3.
23261940 2013 NADPH oxidase 2-derived superoxide downregulates endothelial KCa3.1 in preeclampsia.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21872912 2011 Functional KCa3.1 K+ channels are required for human fibrocyte migration.
21725609 2011 PRL-3 promotes the proliferation of LoVo cells via the upregulation of KCNN4 channels.
21551009 2011 Hypoxic exercise training causes erythrocyte senescence and rheological dysfunction by depressed Gardos channel activity.
21465474 2012 Dynamic redistribution of calcium sensitive potassium channels (hK(Ca)3.1) in migrating cells.
21345794 2011 Involvement of dominant-negative spliced variants of the intermediate conductance Ca2+-activated K+ channel, K(Ca)3.1, in immune function of lymphoid cells.
21228320 2011 Dual-color quantum dot detection of a heterotetrameric potassium channel (hKCa3.1).
21172909 2011 Endothelium-dependent vasodilation in human mesenteric artery is primarily mediated by myoendothelial gap junctions intermediate conductance calcium-activated K+ channel and nitric oxide.
21123738 2011 Calcium-activated K+ channels increase cell proliferation independent of K+ conductance.
20808839 2010 Calcium-activated potassium channels BK and IK1 are functionally expressed in human gliomas but do not regulate cell proliferation.
20720181 2010 ESCRT-dependent targeting of plasma membrane localized KCa3.1 to the lysosomes.
20712009 2010 Intermediate conductance Ca2+ activated K+ channels are expressed and functional in breast adenocarcinomas: correlation with tumour grade and metastasis status.
20501432 2009 Identification and functional characterization of the intermediate-conductance Ca(2+)-activated K(+) channel (IK-1) in biliary epithelium.
20407432 2010 KCNN4 gene variant is associated with ileal Crohn's Disease in the Australian and New Zealand population.
20036632 An investigation of the occurrence and properties of the mitochondrial intermediate-conductance Ca2+-activated K+ channel mtKCa3.1.
19823864 2010 ER-localized bestrophin 1 activates Ca2+-dependent ion channels TMEM16A and SK4 possibly by acting as a counterion channel.
19644414 2009 Relationship between haplotypes of KCNN4 gene and susceptibility to human vascular diseases in Japanese.
19608980 2009 Nitric oxide increases cardiac IK1 by nitrosylation of cysteine 76 of Kir2.1 channels.
19587117 2009 The class II phosphatidylinositol 3 kinase C2beta is required for the activation of the K+ channel KCa3.1 and CD4 T-cells.
19409928 2009 Potassium channel expression in human CD4+ regulatory and naïve T cells from healthy subjects and multiple sclerosis patients.
19406468 2009 Intermediate conductance Ca2+-activated potassium channel (KCa3.1) in the inner mitochondrial membrane of human colon cancer cells.
19270724 2009 Intermediate-conductance Ca2+-activated K+ channels (IKCa1) regulate human prostate cancer cell proliferation through a close control of calcium entry.
19052260 2009 Inhibition of the KCa3.1 channels by AMP-activated protein kinase in human airway epithelial cells.
18796614 2008 Protein histidine phosphatase 1 negatively regulates CD4 T cells by inhibiting the K+ channel KCa3.1.
18792407 2008 Engagement of the EP2 prostanoid receptor closes the K+ channel KCa3.1 in human lung mast cells and attenuates their migration.
18690018 An NH2-terminal multi-basic RKR motif is required for the ATP-dependent regulation of hIK1.
18688283 2008 The intermediate-conductance calcium-activated potassium channel KCa3.1 contributes to atherogenesis in mice and humans.
18547995 2008 KCa3.1 potassium channels are critical for cAMP-dependent chloride secretion and cyst growth in autosomal-dominant polycystic kidney disease.
18367588 2008 IK1 channel activity contributes to cisplatin sensitivity of human epidermoid cancer cells.
18287336 2008 Dynamics of single potassium channel proteins in the plasma membrane of migrating cells.
18227067 2008 Role of S3 and S4 transmembrane domain charged amino acids in channel biogenesis and gating of KCa2.3 and KCa3.1.
18184876 2008 Apparent intermediate K conductance channel hyposmotic activation in human lens epithelial cells.
17762175 2007 Enhancement of P2Y6-induced Cl- secretion by IL-13 and modulation of SK4 channels activity in human bronchial cells.
17585114 2007 KCa3.1 Ca2+ activated K+ channels regulate human airway smooth muscle proliferation.
17474152 2007 Adenosine closes the K+ channel KCa3.1 in human lung mast cells and inhibits their migration via the adenosine A2A receptor.
17470662 2007 Age decline in the activity of the Ca2+-sensitive K+ channel of human red blood cells.
17353352 2007 Structural determinants of the closed KCa3.1 channel pore in relation to channel gating: results from a substituted cysteine accessibility analysis.
17310992 2007 Blockage of intermediate-conductance-Ca(2+) -activated K(+) channels inhibits progression of human endometrial cancer.
17157250 2006 Histidine phosphorylation of the potassium channel KCa3.1 by nucleoside diphosphate kinase B is required for activation of KCa3.1 and CD4 T cells.
17151145 2007 The Ca(2+)-activated K(+) channel KCa3.1 compartmentalizes in the immunological synapse of human T lymphocytes.
16766578 2006 Expression of intermediate-conductance, Ca2+-activated K+ channel (KCNN4) in H441 human distal airway epithelial cells.
16382103 2005 International Union of Pharmacology. LII. Nomenclature and molecular relationships of calcium-activated potassium channels.
16251351 2006 Phosphatidylinositol 3-phosphate indirectly activates KCa3.1 via 14 amino acids in the carboxy terminus of KCa3.1.
15965951 2006 Subcellular distribution of calcium-sensitive potassium channels (IK1) in migrating cells.
15831468 2005 The phosphatidylinositol 3-phosphate phosphatase myotubularin- related protein 6 (MTMR6) is a negative regulator of the Ca2+-activated K+ channel KCa3.1.
15817638 2005 Beta2-adrenoceptor regulation of the K+ channel iKCa1 in human mast cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15452196 2004 New insights on the voltage dependence of the KCa3.1 channel block by internal TBA.
15339840 2005 Distribution of dehydration rates generated by maximal Gardos-channel activation in normal and sickle red blood cells.
15039018 2004 Modulation of Gardos channel activity by oxidants and oxygen tension: effects of 1-chloro-2,4-dinitrobenzene and phenazine methosulphate.
14754884 2004 Role of the NH2 terminus in the assembly and trafficking of the intermediate conductance Ca2+-activated K+ channel hIK1.
14724753 2003 Modulation of calcium-dependent chloride secretion by basolateral SK4-like channels in a human bronchial cell line.
12773623 2003 The hSK4 (KCNN4) isoform is the Ca2+-activated K+ channel (Gardos channel) in human red blood cells.
12612194 2003 Modulation of Ca2+-activated Cl- secretion by basolateral K+ channels in human normal and cystic fibrosis airway epithelia.
12609997 2003 Molecular localization of the inhibitory arachidonic acid binding site to the pore of hIK1.
12493744 2003 Trafficking of the Ca2+-activated K+ channel, hIK1, is dependent upon a C-terminal leucine zipper.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12434576 2002 Calcium-activated potassium channel expression in human myometrium: effect of pregnancy.
12421833 2003 Unexpected down-regulation of the hIK1 Ca2+-activated K+ channel by its opener 1-ethyl-2-benzimidazolinone in HaCaT keratinocytes. Inverse effects on cell growth and proliferation.
12198491 2002 Lon protease preferentially degrades oxidized mitochondrial aconitase by an ATP-stimulated mechanism.
11425865 2001 Delineation of the clotrimazole/TRAM-34 binding site on the intermediate conductance calcium-activated potassium channel, IKCa1.
10961988 2000 Up-regulation of the IKCa1 potassium channel during T-cell activation. Molecular mechanism and functional consequences.
10880439 2000 Inhibition of human ether à go-go potassium channels by Ca(2+)/calmodulin.
10026195 1999 Calmodulin mediates calcium-dependent activation of the intermediate conductance KCa channel, IKCa1.
9693050 1998 Human calcium-activated potassium channel gene KCNN4 maps to chromosome 19q13.2 in the region deleted in diamond-blackfan anemia.
9407042 1997 A novel gene, hKCa4, encodes the calcium-activated potassium channel in human T lymphocytes.
9380751 1997 hSK4, a member of a novel subfamily of calcium-activated potassium channels.
9326665 1997 A human intermediate conductance calcium-activated potassium channel.