Property Summary

Ligand Count 27
NCBI Gene PubMed Count 30
PubMed Score 20.47
PubTator Score 62.40

Knowledge Summary

Patent (8,976)

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma -2.575 2.2e-03
adult high grade glioma -1.100 4.5e-02
astrocytoma 1.100 7.0e-05
Astrocytoma, Pilocytic -2.700 4.2e-08
atypical teratoid / rhabdoid tumor -2.100 6.7e-03
ependymoma -1.400 5.2e-03
glioblastoma -1.100 3.2e-02
group 4 medulloblastoma -2.300 1.6e-05
intraductal papillary-mucinous carcinoma... -1.500 6.7e-04
intraductal papillary-mucinous neoplasm ... -1.100 3.3e-02
malignant mesothelioma -5.800 1.1e-09
medulloblastoma, large-cell -2.500 1.5e-05
oligodendroglioma 1.700 2.0e-03
pituitary cancer -2.200 2.3e-03
primitive neuroectodermal tumor -1.700 1.1e-02

Gene RIF (17)

AA Sequence

MSSCRYNGGVMRPLSNLSASRRNLHEMDSEAQPLQPPASVGGGGGASSPSAAAAAAAAVSSSAPEIVVSK      1 - 70
PEHNNSNNLALYGTGGGGSTGGGGGGGGSGHGSSSGTKSSKKKNQNIGYKLGHRRALFEKRKRLSDYALI     71 - 140
FGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMT    141 - 210
YERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLF    211 - 280
TDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMW    281 - 350
LISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVK    351 - 420
NAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMY    421 - 490
DMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTIRQQQRDFIEAQMESYDKHVTYNAERSRS    491 - 560
SSRRRRSSSTAPPTSSESS                                                       561 - 579
//

Text Mined References (32)

PMID Year Title