Property Summary

Ligand Count 21
NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 28.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.100 5.7e-03
Astrocytoma, Pilocytic -1.300 6.8e-06
atypical teratoid / rhabdoid tumor -1.300 1.1e-06
ependymoma -1.500 1.9e-13
glioblastoma -1.400 2.6e-08
medulloblastoma -1.100 4.3e-03
osteosarcoma 2.019 3.1e-07
primitive neuroectodermal tumor -1.100 3.5e-02
psoriasis 1.800 1.1e-04

Gene RIF (5)

AA Sequence

MNSHSYNGSVGRPLGSGPGALGRDPPDPEAGHPPQPPHSPGLQVVVAKSEPARPSPGSPRGQPQDQDDDE      1 - 70
DDEEDEAGRQRASGKPSNVGHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSWGVYTKESLYSF     71 - 140
ALKCLISLSTAILLGLVVLYHAREIQLFMVDNGADDWRIAMTCERVFLISLELAVCAIHPVPGHYRFTWT    141 - 210
ARLAFTYAPSVAEADVDVLLSIPMFLRLYLLGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTI    211 - 280
CPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLT    281 - 350
GIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQARV    351 - 420
RKHQRKFLQAIHQAQKLRSVKIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEARLATLESRLD    421 - 490
ALGASLQALPGLIAQAIRPPPPPLPPRPGPGPQDQAARSSPCRWTPVAPSDCG                     491 - 543
//

Text Mined References (13)

PMID Year Title