Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.19
PubTator Score 27.47

Knowledge Summary

Patent (2,171)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Celiac disease 110 0.0 1.8

Expression

Gene RIF (6)

AA Sequence

MDFSPSSELGFHFVAFILLTRHRTAFPASGKKRETDYSDGDPLDVHKRLPSSAGEDRAVMLGFAMMGFSV      1 - 70
LMFFLLGTTILKPFMLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQVFVNLSHPGQKAL     71 - 140
LHYNEEAVQINPKCFYTPKCHQDRNDLLNSALDIKEFFDHKNGTPFSCFYSPASQSEDVILIKKYDQMAI    141 - 210
FHCLFWPSLTLLGGALIVGMVRLTQHLSLLCEKYSTVVRDEVGGKVPYIEQHQFKLCIMRRSKGRAEKS     211 - 279
//

Text Mined References (20)

PMID Year Title