Property Summary

NCBI Gene PubMed Count 26
PubMed Score 0.09
PubTator Score 6779.07

Knowledge Summary

Patent (962)

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.800 1.4e-02
oligodendroglioma -1.500 3.5e-02
posterior fossa group A ependymoma -1.500 4.7e-06
medulloblastoma -2.100 6.2e-04
atypical teratoid / rhabdoid tumor -2.000 1.0e-03
glioblastoma -1.800 8.1e-03
medulloblastoma, large-cell -2.400 2.8e-04
pediatric high grade glioma -1.100 3.2e-02
pituitary cancer -1.300 1.8e-04
chronic rhinosinusitis -1.549 1.3e-02
cystic fibrosis and chronic rhinosinusit... -1.620 2.8e-02

Gene RIF (7)

PMID Text
24414257 IFN-gamma changed mRNA levels of the BK beta-modulatory proteins KCNMB2 (increased) and KCNMB4 (decreased) as well as leucine-rich repeat-containing protein (LRRC)26 (decreased).
23825428 beta subunits of large-conductance calcium-dependent potassium channels modulate the interface between membrane-spanning and cytosolic domains.
19204046 Report beta subunit (KNMB1-4)-specific modulations of BK channel function by a Slo1 mutation associated with epilepsy and dyskinesia.
17521822 reports that coexpression of beta2 subunit (KCNMB2) with hSlo can also modulate hSlo surface expression levels in HEK293T cells
17460083 significance of inactivation in BK channels mediated by beta subunits arises not from inactivation, but from differences in the amplitude and duration of repolarizing currents arising from the beta-subunit-specific energetics of recovery from inactivation
16446507 results reveal the molecular regions in the beta1 and beta2 subunits that determine their differential functional coupling with the pore-forming alpha-subunit
10758170 HIV-1 gp120 from both CCR5- and CXCR4-tropic HIV-1 strains opens calcium-activated potassium (K(Ca)), chloride, and calcium-permeant nonselective cation channels in macrophages; these signals are mediated by CCR5 and CXCR4

AA Sequence

MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIMMYFLLGITLL      1 - 70
RSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQ     71 - 140
KCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSNVLFHSLFWPTCMMAGG    141 - 210
VAIVAMVKLTQYLSLLCERIQRINR                                                 211 - 235
//

Text Mined References (26)

PMID Year Title
25825171 2015 Two distinct effects of PIP2 underlie auxiliary subunit-dependent modulation of Slo1 BK channels.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24414257 2014 IFN-?-mediated reduction of large-conductance, Ca2+-activated, voltage-dependent K+ (BK) channel activity in airway epithelial cells leads to mucociliary dysfunction.
23825428 2013 The interface between membrane-spanning and cytosolic domains in Ca²+-dependent K+ channels is involved in ? subunit modulation of gating.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
20859064 2010 Novel spliced variants of large-conductance Ca(2+)-activated K(+)-channel ?2-subunit in human and rodent pancreas.
19684603 2009 Germline genomic variants associated with childhood acute lymphoblastic leukemia.
19204046 2009 {beta} subunit-specific modulations of BK channel function by a mutation associated with epilepsy and dyskinesia.
17521822 2007 Endocytic trafficking signals in KCNMB2 regulate surface expression of a large conductance voltage and Ca(2+)-activated K+ channel.
17460083 2007 BK channels with beta3a subunits generate use-dependent slow afterhyperpolarizing currents by an inactivation-coupled mechanism.
16446507 2006 Structural determinants for functional coupling between the beta and alpha subunits in the Ca2+-activated K+ (BK) channel.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14522958 2003 Post-transcriptional control of human maxiK potassium channel activity and acute oxygen sensitivity by chronic hypoxia.
12566540 2003 Inactivation of BK channels by the NH2 terminus of the beta2 auxiliary subunit: an essential role of a terminal peptide segment of three hydrophobic residues.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12136044 2002 New disguises for an old channel: MaxiK channel beta-subunits.
11517232 2001 NMR structure of the "ball-and-chain" domain of KCNMB2, the beta 2-subunit of large conductance Ca2+- and voltage-activated potassium channels.
11181995 2001 The sequence of the human genome.
10792058 2000 A neuronal beta subunit (KCNMB4) makes the large conductance, voltage- and Ca2+-activated K+ channel resistant to charybdotoxin and iberiotoxin.
10766764 2000 Cloning and functional expression of two families of beta-subunits of the large conductance calcium-activated K+ channel.
10692449 2000 Cloning and functional characterization of novel large conductance calcium-activated potassium channel beta subunits, hKCNMB3 and hKCNMB4.
10377337 1999 Molecular basis for the inactivation of Ca2+- and voltage-dependent BK channels in adrenal chromaffin cells and rat insulinoma tumor cells.
10097176 1999 Molecular basis of fast inactivation in voltage and Ca2+-activated K+ channels: a transmembrane beta-subunit homolog.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.