Property Summary

Ligand Count 44
NCBI Gene PubMed Count 180
PubMed Score 1238.47
PubTator Score 306.08

Knowledge Summary

Patent (36,302)

TINX Plot

  Disease (8)

Disease Target Count
Muscle Spasm with Pain 3
Spasticity 26
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Epilepsy 792 0.0 4.0

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma -3.600 2.0e-06
astrocytic glioma -3.100 3.1e-03
Astrocytoma, Pilocytic -1.600 8.9e-05
atypical teratoid / rhabdoid tumor -1.500 8.4e-05
Breast cancer -1.300 6.3e-03
colon cancer -4.700 5.0e-07
cystic fibrosis 1.154 1.7e-04
Endometriosis -1.385 2.1e-02
ependymoma -2.800 3.0e-03
glioblastoma -1.100 3.2e-04
group 3 medulloblastoma -1.600 8.7e-03
interstitial cystitis 1.300 3.6e-02
intraductal papillary-mucinous adenoma (... -1.100 2.3e-03
intraductal papillary-mucinous neoplasm ... -1.100 2.6e-03
lung cancer 2.200 9.4e-04
lung carcinoma 2.900 1.9e-26
malignant mesothelioma -5.100 2.5e-09
medulloblastoma, large-cell -1.300 1.3e-02
nasopharyngeal carcinoma 1.300 2.8e-03
oligodendroglioma -2.300 1.5e-02
pancreatic ductal adenocarcinoma liver m... -1.156 2.3e-02
primitive neuroectodermal tumor -1.700 2.4e-03
psoriasis -2.300 1.7e-05
sarcoidosis 1.600 3.1e-02

Gene RIF (138)

AA Sequence

MANGGGGGGGSSGGGGGGGGSSLRMSSNIHANHLSLDASSSSSSSSSSSSSSSSSSSSSSVHEPKMDALI      1 - 70
IPVTMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKINNGSSQADG     71 - 140
TLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSNPIESCQNFY    141 - 210
KDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLI    211 - 280
QFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTM    281 - 350
STVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLES    351 - 420
VSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLIL    421 - 490
ANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA    491 - 560
QSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLM    561 - 630
IAIEYKSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRPKM    631 - 700
SIYKRMRRACCFDCGRSERDCSCMSGRVRGNVDTLERAFPLSSVSVNDCSTSFRAFEDEQPSTLSPKKKQ    701 - 770
RNGGMRNSPNTSPKLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSG    771 - 840
HVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRA    841 - 910
DLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPD    911 - 980
NSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSAT    981 - 1050
YFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADLGDGGCYG   1051 - 1120
DLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAGQSRASLS   1121 - 1190
HSSHSSQSSSKKSSSVHSIPSTANRQNRPKSRESRDKQKYVQEERL                           1191 - 1236
//

Text Mined References (184)

PMID Year Title