Property Summary

NCBI Gene PubMed Count 161
PubMed Score 1170.65
PubTator Score 306.08

Knowledge Summary

Patent (36,302)

TINX Plot

  Disease (8)

Disease Target Count
Muscle Spasm with Pain 3
Spasticity 26
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Epilepsy 346 0.0 4.0

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -5.800 4.9e-10
astrocytic glioma -3.100 3.1e-03
ependymoma -3.000 9.2e-11
oligodendroglioma -2.500 5.3e-17
psoriasis -2.300 1.7e-05
glioblastoma -4.600 1.0e-06
medulloblastoma -3.700 3.4e-07
cystic fibrosis 1.412 6.1e-06
atypical teratoid / rhabdoid tumor -5.200 4.0e-12
medulloblastoma, large-cell -4.500 1.2e-05
primitive neuroectodermal tumor -3.400 9.6e-04
pancreatic ductal adenocarcinoma liver m... -1.156 2.3e-02
intraductal papillary-mucinous adenoma (... -2.100 4.6e-04
intraductal papillary-mucinous neoplasm ... -2.900 5.5e-04
lung cancer 2.200 9.4e-04
colon cancer -4.700 5.0e-07
sarcoidosis 1.600 3.1e-02
interstitial cystitis 1.300 3.6e-02
pediatric high grade glioma -3.700 3.1e-08
pilocytic astrocytoma -1.600 8.4e-05
nasopharyngeal carcinoma 1.300 2.8e-03
Endometriosis -1.385 2.1e-02
lung carcinoma 2.900 1.9e-26
Breast cancer -1.300 6.3e-03

Protein-protein Interaction (1)

Gene RIF (122)

PMID Text
26390131 Results indicate that silencing BKCa (KCa1.1) inhibits cell mobility, while silencing IKir (Kir2.1) increases cell mobility in human cardiac c-kit+ progenitor cells.
26009545 Suggest that BK channel modulation by auxiliary gamma subunits depends on intra- and/or juxta-membrane mechanisms.
25796627 Suberoylanilide hydroxamic acid enhanced the expression of malignant genes such as KCNMA1 in lung cancer cells remaining after treatment, creating a more drug-resistant state.
25511389 The present study revealed that 11,12-EET targets the TRPV4-TRPC1-KCa1.1 complex to induce smooth muscle cell hyperpolarization and vascular relaxation in human LIMAs.
25345746 DS-201 selectively targets the pore-forming alpha subunit of human BKCa channels, thus enhancing the channel activities and increasing the subunit expression and trafficking.
25070892 our results strongly suggest that AT1R regulates BK channels through a close protein-protein interaction involving multiple BK regions and independent of G-protein activation.
24759175 Recombinant martentoxin selectively blocks KCNMA1/KCNMB4 channels.
24705869 hSlo1c associates with Cav-1 in human brain microvascular endothelial cells.A 57-amino acid (966-1022) fragment in hSlo1c was identified to be critical for hSlo1c/Cav-1 interaction.
24696148 Overexpression of JAK2 in alveolar rhabdomyosarcoma cells significantly enhanced BK channel mRNA and protein abundance.
24602615 Activation of GalR2 leads to elevation of intracellular Ca(2+) due to Ca(2+) efflux from endoplasmic reticulum through IP3R sequentially opening BK alpha channels.
24569989 N-terminal isoforms of the large-conductance Ca(2)-activated K channel are differentially modulated by the auxiliary beta1-subunit.
24476761 Bisphenol A activates BK alpha via an extracellular site and that Bisphenol A-sensitivity is increased by the beta1 subun
24414257 Overexpression of KCNMA1, the pore-forming subunit of BK, overcame the reduction of airway surface liquid volume induced by IFN-gamma.
24375290 We conclude that arachidonic acid itself selectively activates the beta1-associated BKCa channel, destabilizing its closed state probably by interacting with the beta1-subunit, without modifying the channel voltage sensitivity
24260325 The reduced KCa1.1 channel protein expression was also observed.
24137539 show that Slo1 is localized to the sperm flagellum and is inhibited by progesterone. Inhibition of hKSper by progesterone may depolarize the spermatozoon to open the calcium channel CatSper
24127525 Here we examined the action of docosahexaenoic acid on the Slo1 channel without any auxiliary subunit and sought to elucidate the biophysical mechanism and the molecular determinants of the DHA sensitivity.
24067659 The SLO1 gating ring is not required for voltage activation but is required for Ca2+ and Mg2+ activation.
23992640 A molecular and functional link between BKCa channel and IP3R3 in cancer cells as an important mechanism for tumor cell proliferation.
23831469 BK-IS1 (44-113) alpha subunit has been over-expressed using a bacterial system and purified in the presence of detergent micelles for multidimensional heteronuclear nuclear magnetic resonance (NMR) structural studies.
23626738 A novel Cav3-KCa1.1 signaling complex has been identified where Cav3-mediated calcium entry enables KCa1.1 activation over a wide range of membrane potentials.
23508624 HIV and methamphetamine -induced elevated miR-9 lead to suppression of miR-response element-containing splice variants of KCNMA1
23267835 BK(Ca) as a crucial part of the signaling cascade of LH/hCG in Leydig cells.
23237801 These results strongly suggest that cav3 possesses direct interaction with KCa1.1, presumably at the same domain for cav1 binding.
23232643 whole-cell current, spontaneous transient outward current, and Ca(2+) sensitivity of BK(Ca) channels are reduced in human vascular smooth muscle cells. This may account for the dysfunction of artery relaxation in primary hypertension.
22899999 enhanced expression of KCNMA1 correlates with and contributes to high proliferation rate and malignancy of breast cancer.
22896041 Phosphodiesterase blockade causes relaxation of human urinary bladder smooth muscle by increasing transient K(Ca)1.1 channel current activity, hyperpolarizing cell membrane potential, and decreasing the global intracellular Ca(2+).
22710124 TM1 of the beta2-subunit physically binds to the transmembrane S1 domain of the alpha-subunit of BK potassium channels
22538239 The effects of protein kinase C on Slo surface expression might be indirect; when clustered on hair cell membranes, Slo contributes to increasing amounts of channel clusters on high-frequency responsiveness of hair-cell membranes.
22474334 Multiple cholesterol recognition/interaction amino acid consensus (CRAC) motifs in cytosolic C tail of Slo1 subunit determine cholesterol sensitivity of Ca2+- and voltage-gated K+ (BK) channels.
22446331 BK(Ca) channels are involved in the response of podocytes to chronic hypoxia via the upregulation of the beta4-subunit.
22331907 Cym04 reversibly left-shifts the Slo1 half-activation voltage. It interacts with the S6/RCK linker & mimics site-specific shortening of this passive spring, transmiting force from the cytosolic gating ring structure opening the channel's gate.
22194818 These studies identify for the first time a central role for beta-catenin in mediating Slo surface expression.
22140451 Membrane cholesterol influences ethanol's modulation of BK.
22074915 identified the calcium- and voltage-gated KCa1.1 channel (BK, Maxi-K, Slo1, KCNMA1) as the major potassium channel expressed at the plasma membrane of FLS isolated from patients with RA (RA-FLS).
21757754 the nongenomic PI3K signaling pathway plays a role in estrogen/hERalpha-stimulated hSlo1 gene expression; whereas c-Src activity leads to hSlo1 gene tonic repression independently of estrogen, likely through ERK activation.
21724437 The BK(Ca) K(+) channel was impaired in Smith-Lemli-Opitz syndrome cells as reflected by reduced single channel conductance and a 50 mV rightward shift in the channel activation voltage.
21708048 Genome wide association study identifies KCNMA1 contributing to human obesity
21670298 Myristoylation occurs mainly at hSlo1 intracellular loop 1 or 3, and is an additional mechanism for channel surface expression regulation
21613417 WNK4 WT inhibits Maxi K activity by reducing Maxi K protein at the membrane, but the inhibition is not due to an increase in clathrin-mediated endocytosis of Maxi K, but likely due to enhancing its lysosomal degradation.
21413024 Cloned BK(Ca) channel directly regulated apoptosis and proliferation of HEK293 cell under hyperglycemia condition.
21301863 a specific cysteine residue in the C-terminal domain, which is close to the Ca(2+) bowl but which is not involved in Ca(2+) activation, confers significant CO sensitivity to BK(Ca) channels
21078868 Relative motion of transmembrane segments S0 and S4 during voltage sensor activation in the human BK(Ca) channel
21072171 Findings show that miR-211 is a direct posttranscriptional regulator of KCNMA1 expression.
20959415 vasoconstrictor TP receptor and MaxiK-channel direct interaction facilitates G-protein-independent TP to MaxiK trans-inhibition, which would promote vasoconstriction.
20808839 Ca(2+)-activated K(+) channels do not play a critical role in proliferation of glioma cells
20677014 Observational study of gene-disease association. (HuGE Navigator)
20630939 Podocyte BK(Ca) channels are regulated by synaptopodin, Rho, and actin microfilaments.
20624858 RCK1 domain is a high-affinity Ca(2+) sensor that transduces Ca(2+) binding into structural rearrangements, likely representing elementary steps in the Ca(2+)-dependent activation of human BK(Ca) channels.
20574420 crystal structure of the entire cytoplasmic region of the human BK channel in a Ca(2+)-free state
20508092 study determined the x-ray structure of the BK Ca2+ gating apparatus at a resolution of 3.0 angstroms and deduced its tetrameric assembly by solving a 6 angstrom resolution structure of a Na+-activated homolog
20479001 Alternative splicing of the intracellular RCK1-RCK2 linker plays a critical role in determining cell surface expression of BK channels by controlling the inclusion/exclusion of multiple trafficking motifs.
20457834 In transfected HEK293 cells, activation of cloned BK(Ca) channel induced apoptosis, whereas inhibition of cloned BK(Ca) channel decreased apoptosis.
20427280 Data suggest that the thiol/disulfide switch in the HBD is a mechanism by which activity of the BK channel can respond quickly and reversibly to changes in the redox state of the cell.
20424473 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20051533 Dominant-negative regulation of cell surface expression by a pentapeptide motif at the extreme COOH terminus of an Slo1 calcium-activated potassium channel splice variant.
20037152 Slo1 BK channels represent a positive and direct effector of Zn(2+) signaling and may participate in sculpting cellular response to an increase in intracellular Zn(2+) concentration
20012488 These results indicated that activation of cloned BK(Ca) channel was involved in nitric oxide-induced apoptosis of HEK293 cells.
19738431 Data showed that KCa channel activity appears to increase with the increased glioma malignancy.
19718020 the first single-particle cryo-EM study of a membrane protein, the human large-conductance calcium- and voltage-activated potassium channel (BK), in a lipid environment
19640305 KCNMA1 has a role in breast cancer invasion and metastasis to brain
19617704 comparative mechanisms of the channel activation by Ca(2+) and H(+).
19552602 BKCa channel activation increases outflow facility and decreases cell volume suggesting that K+ efflux regulates trabecular meshwork cell function
19456106 The solution structure of KCNMA1 alpha subunit reveals a helix-turn-helix motif, which is in agreement with crystal structures of other voltage-gated potassium channels, thus indicating that it is feasible to study the isolated fragment.
19430934 The expressed hSloalpha + beta1 subunit complex demonstrated to be fully functional for its typical single-channel traces, Ca(2+)-sensitivity, voltage-dependency, high conductance (151 +/- 7 pS), and its pharmacological activation and inhibition.
19344525 Expression of BKCa alpha- and beta-subunit in pregnant myometrium is reduced during labour.
19204046 Report beta subunit (KNMB1-4)-specific modulations of BK channel function by a Slo1 mutation associated with epilepsy and dyskinesia.
19168436 TRPC1 associates with BK(Ca) channel to form a signal complex in vascular smooth muscle cells.
19118164 Nardilysin convertase regulates the function of the maxi-K channel isoform mK44 in human myometrium.
19096717 BK channels coupled directly to these Ca2+ channels may provide a good tool for negative feedback control of the L-type Ca2+ channels.
19052171 Cytosolic domains of the pore-forming subunits of BKCa channels associate with TRPC6 and TRPC3 channels, both of which are expressed in podocytes.
18854754 The present findings are compatible with an association of KCNMA1 genetic variations with increased risk of systolic severe hypertension and myocardial infarction.
18854754 Observational study of gene-disease association. (HuGE Navigator)
18719396 the evolutionarily preserved splicing of the Slo1 S6-RCK1 linker segment possess great potential to fine-tune neuronal excitability
18559348 Structural basis for toxin resistance of beta4-associated calcium-activated potassium (BK) channels.
18480178 Reduction of endogenous nephrin expression by application of siRNA to differentiated cells of an immortalized podocyte cell line markedly reduced steady-state surface expression of Slo1.
18414909 Nonsense mutation (R419X) CRBN disturbs the development of adult brain BK(Ca) isoforms. These changes are predicted to result in BK(Ca) channels with a higher intracellular Ca(2+) sensitivity, faster activation, and slower deactivation kinetics.
18404672 BK channels play a functional role in carcinogenesis. BK channels exhibit antitumoral properties in OS in vivo and affect the tumor microenvironment through the modulation of both chemokine expression and leukocyte infiltration.
18385281 NO-induced regulation of human trabecular meshwork cell volume and aqueous humor outflow facility involve the BKCa ion channel.
18367663 insulin activates BK in the plasma membrane of mesangial cells and stimulates, via MAPK, an increase in cellular and plasma membrane BK-alpha
18345016 common motif in the RCK1 domain of SLO1 mediates the stimulatory effects of both H+ and Ca2+, and provides a basis for the bidirectional coupling of cell metabolism and membrane electrical excitability
18316727 Carbon monoxide acts as a partial agonist for the high-affinity divalent cation sensor in the RCK1 domain of the Slo1 BK channel.
18227273 The influence of the intrinsic electrostatic potential on the channel conductance of KCNMA1 was studied experimentally and theoretically by amino acid substitution.
18180950 Show that a motif in the S9-S10 part of the C-terminal of KCNMA1 is essential for carbon monoxide activation. CO may activate KCNMA1 by redox-independent changes in gating.
18162557 analysis of how the RCK2 domain of the human BKCa channel is a calcium sensor
18084004 Acute alcohol tolerance is intrinsic to the BKCa protein, but is modulated by the lipid environment
17989352 Slo1-actin interactions are necessary for normal trafficking of calcium channels to the plasma membrane.
17901123 data suggest sensory nerves and BKCa channels play major roles in the EDHF component of reactive hyperaemia and appear to work partly independent of each other
17591990 the beta(2) subunit of BK(Ca) channels facilitates channel activation by changing the voltage sensor equilibrium and that the beta(2)-induced inactivation process does not follow a typical N-type mechanism
17591987 A study evaluating the mechanism of gating of MaxiK is reported.
17586600 Interactions with filamin A stimulate surface expression of KCNMA1 in the absence of direct actin binding.
17521822 reports that coexpression of beta2 subunit (KCNMB2) with hSlo can also modulate hSlo surface expression levels in HEK293T cells
17483867 The activity of BK(Ca) channels present in human cardiac fibroblasts may contribute to the functional activities of heart cells through transfer of electrical signals between these two cell types.
17468961 both the inner and outer domains of the KCNMA1 channel where these two channel functions are localized respond to deformation and that a fixed amount of distortion results in reciprocal changes in protein function.
17166942 RACK1 binds to the BK(Ca) channel and it may form part of a BK(Ca)-channel regulatory complex in vascular smooth muscle.
17150299 Alternative splicing of this protein may represent a mechanism with which relaxation of corporal tissue may be triggered as a result of a diabetes-related decline in erectile capacity.
17146446 Amplification of chromosomal region 10q22 drives KCNMA1 expression and cell proliferation in prostate cancer.
16951373 Appears to be a central molecule in the NF-kappa B-dependent inflammatory response of macrophages to bacterial lipopolysaccharides.
16895996 Results describe the conformational changes that the large conductance voltage- and Ca(2+)-activated K(+) channel undergoes during activation.
16790810 Evidence is provided for functional association of the MaxiK channel and toll-like receptor signaling complexes in human macrophages.
16396928 Oxidation of M536, M712 or M739 may enhance the Slo1 BK activity during conditions of oxidative stress, such as those associated with ischaemia-reperfusion and neurodegenerative disease, or in response to metabolic cues.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16100257 analysis of C-terminal residues that contribute to the Ca2+ sensitivity of a BKCa channel
16042390 The Maxi-K channel domain ranging from the N-terminus through the S6 linker region contains the determinants necessary for formation and surface expression of tetramers, while the C-terminus is needed for normal channel gating and surface expression.
15937479 mutated in generalized epilepsy and paroxysmal dyskinesia and have implications for the pathogenesis of human epilepsy, the neurophysiology of paroxysmal movement disorders and the role of BK channels in neurological disease
15849354 Present findings suggest that hslo gating structures targeted by ethanol are accessible to sense changes in bilayer stress.
15703204 Actin cytoskeleton is involved as part of a caveolar complex in the regulation of myometrial maxi-K channel function.
15528406 Hemoxygenase-2 is part of the BK channel complex and enhances channel activity in normoxia
15280542 cAMP-dependent protein kinase (PKA) phosphorylation of the conserved C-terminal PKA consensus site (S899) in all four BKCa alpha-subunits is required for channel activation
14584897 pp125FAK interacts with the large conductance calcium-activated hSlo potassium channel in human osteoblasts: potential role in mechanotransduction
14523450 electrophysiological and structural evidence showing that haem directly regulates cloned human Slo1 channels and wild-type BK channels in rat brain
14522958 Chronic hypoxia caused no change in alpha-subunit but evoked a 3-fold increase in beta-subunit expression, and augmented alpha/beta-subunit co-localization at the plasma membrane; maxiK channel function is modulated via post-transcriptional mechanisms.
12438308 the cytoplasmic tail of rbslo1 is important for the cell surface expression of MaxiK channels
12391293 propose that MaxiK channels via direct c-Src-dependent phosphorylation play a significant role supporting vasoconstriction after activation of G protein-coupled receptors by vasoactive substances and neurotransmitters
12223479 pore-forming alpha subunit of the hSlo channel promotes N-linked glycosylation of its auxiliary beta4 subunit, and this in turn influences the modulation of the channel by the beta4 subunit
12161564 Stepwise contribution of each subunit to the cooperative activation of channels by calcium
12016222 N-terminal variation and strex exon splicing in rSlo interact to produce BK(Ca) channels with a physiologically relevant phenotype.
12009018 besides its conductance function, hSlo channel can behave in bone cells, as a true transduction protein intervening in the bone remodeling induced by PGE2
11986367 Inhibited by hypoxia by a mechanism which is membrane delimited and Ca(2+) sensitive.
11832330 The targets of H2O2 action are located in the intracellular aspect of the channel and the H2O2 effect on channel activity is mediated by hydroxyl radical
10758170 HIV-1 gp120 from both CCR5- and CXCR4-tropic HIV-1 strains opens calcium-activated potassium (K(Ca)), chloride, and calcium-permeant nonselective cation channels in macrophages; these signals are mediated by CCR5 and CXCR4

AA Sequence

MANGGGGGGGSSGGGGGGGGSSLRMSSNIHANHLSLDASSSSSSSSSSSSSSSSSSSSSSVHEPKMDALI      1 - 70
IPVTMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKINNGSSQADG     71 - 140
TLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSNPIESCQNFY    141 - 210
KDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLI    211 - 280
QFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTM    281 - 350
STVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLES    351 - 420
VSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLIL    421 - 490
ANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA    491 - 560
QSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLM    561 - 630
IAIEYKSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRPKM    631 - 700
SIYKRMRRACCFDCGRSERDCSCMSGRVRGNVDTLERAFPLSSVSVNDCSTSFRAFEDEQPSTLSPKKKQ    701 - 770
RNGGMRNSPNTSPKLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSG    771 - 840
HVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRA    841 - 910
DLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPD    911 - 980
NSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSAT    981 - 1050
YFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADLGDGGCYG   1051 - 1120
DLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAGQSRASLS   1121 - 1190
HSSHSSQSSSKKSSSVHSIPSTANRQNRPKSRESRDKQKYVQEERL                           1191 - 1236
//

Text Mined References (165)

PMID Year Title
26390131 2015 Effects of BKCa and Kir2.1 Channels on Cell Cycling Progression and Migration in Human Cardiac c-kit+ Progenitor Cells.
26247146 2015 Time-Dependent Effects of Ethanol on BK Channel Expression and Trafficking in Hippocampal Neurons.
26009545 2015 Molecular basis for differential modulation of BK channel voltage-dependent gating by auxiliary ? subunits.
25796627 2015 Enhancement of tumor initiation and expression of KCNMA1, MORF4L2 and ASPM genes in the adenocarcinoma of lung xenograft after vorinostat treatment.
25511389 2015 Epoxyeicosatrienoic acids act through TRPV4-TRPC1-KCa1.1 complex to induce smooth muscle membrane hyperpolarization and relaxation in human internal mammary arteries.
25345746 2014 Tanshinone II-A sodium sulfonate (DS-201) enhances human BKCa channel activity by selectively targeting the pore-forming ? subunit.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
25070892 2014 The angiotensin II type 1 receptor (AT1R) closely interacts with large conductance voltage- and Ca2+-activated K+ (BK) channels and inhibits their activity independent of G-protein activation.
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
24759175 2014 Recombinant expression and functional characterization of martentoxin: a selective inhibitor for BK channel (? + ?4).
24705869 2014 C-terminus of human BKca channel alpha subunit enhances the permeability of the brain endothelial cells by interacting with caveolin-1 and triggering caveolin-1 intracellular trafficking.
24696148 2014 Upregulation of the large conductance voltage- and Ca2+-activated K+ channels by Janus kinase 2.
24602615 2014 Activation of galanin receptor 2 stimulates large conductance Ca(2+)-dependent K(+) (BK) channels through the IP3 pathway in human embryonic kidney (HEK293) cells.
24569989 2014 N-terminal isoforms of the large-conductance Ca²?-activated K? channel are differentially modulated by the auxiliary ?1-subunit.
24476761 2014 Bisphenol A activates BK channels through effects on ? and ?1 subunits.
24414257 2014 IFN-?-mediated reduction of large-conductance, Ca2+-activated, voltage-dependent K+ (BK) channel activity in airway epithelial cells leads to mucociliary dysfunction.
24375290 2014 Arachidonic acid activation of BKCa (Slo1) channels associated to the ?1-subunit in human vascular smooth muscle cells.
24260325 2013 Cholesterol down-regulates BK channels stably expressed in HEK 293 cells.
24137539 2013 Slo1 is the principal potassium channel of human spermatozoa.
24127525 2013 A point mutation in the human Slo1 channel that impairs its sensitivity to omega-3 docosahexaenoic acid.
24067659 2013 Properties of Slo1 K+ channels with and without the gating ring.
23992640 2013 Molecular interaction and functional coupling between type 3 inositol 1,4,5-trisphosphate receptor and BKCa channel stimulate breast cancer cell proliferation.
23831469 2013 Intracellular segment between transmembrane helices S0 and S1 of BK channel ? subunit contains two amphipathic helices connected by a flexible loop.
23626738 2013 Low voltage activation of KCa1.1 current by Cav3-KCa1.1 complexes.
23508624 2013 Modulation of BK channel by MicroRNA-9 in neurons after exposure to HIV and methamphetamine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23267835 2013 The Ca2+-activated, large conductance K+-channel (BKCa) is a player in the LH/hCG signaling cascade in testicular Leydig cells.
23237801 2013 Direct molecular interaction of caveolin-3 with KCa1.1 channel in living HEK293 cell expression system.
23232643 2013 Function of BKCa channels is reduced in human vascular smooth muscle cells from Han Chinese patients with hypertension.
22899999 2012 Role of KCNMA1 in breast cancer.
22896041 2012 Constitutively active phosphodiesterase activity regulates urinary bladder smooth muscle function: critical role of KCa1.1 channel.
22710124 2012 The first transmembrane domain (TM1) of ?2-subunit binds to the transmembrane domain S1 of ?-subunit in BK potassium channels.
22547800 2012 BK potassium channel modulation by leucine-rich repeat-containing proteins.
22538239 2012 Hair cell BK channels interact with RACK1, and PKC increases its expression on the cell surface by indirect phosphorylation.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22474334 2012 Multiple cholesterol recognition/interaction amino acid consensus (CRAC) motifs in cytosolic C tail of Slo1 subunit determine cholesterol sensitivity of Ca2+- and voltage-gated K+ (BK) channels.
22446331 2012 Chronic hypoxia in cultured human podocytes inhibits BKCa channels by upregulating its ?4-subunit.
22399288 2012 Distinct acyl protein transferases and thioesterases control surface expression of calcium-activated potassium channels.
22331907 2012 Molecular mechanism of pharmacological activation of BK channels.
22194818 2011 Interactions between ?-catenin and the HSlo potassium channel regulates HSlo surface expression.
22140451 2011 Cholesterol tuning of BK ethanol response is enantioselective, and is a function of accompanying lipids.
22074915 2012 KCa1.1 potassium channels regulate key proinflammatory and invasive properties of fibroblast-like synoviocytes in rheumatoid arthritis.
21757754 2011 Distinct transcriptional regulation of human large conductance voltage- and calcium-activated K+ channel gene (hSlo1) by activated estrogen receptor alpha and c-Src tyrosine kinase.
21724437 2011 Alterations in membrane caveolae and BKCa channel activity in skin fibroblasts in Smith-Lemli-Opitz syndrome.
21708048 2011 Genome wide association study identifies KCNMA1 contributing to human obesity.
21670298 2011 Unconventional myristoylation of large-conductance Ca²?-activated K? channel (Slo1) via serine/threonine residues regulates channel surface expression.
21613417 2011 WNK4 kinase inhibits Maxi K channel activity by a kinase-dependent mechanism.
21413024 2011 High glucose alters apoptosis and proliferation in HEK293 cells by inhibition of cloned BK Ca channel.
21301863 2011 Cysteine residue 911 in C-terminal tail of human BK(Ca)? channel subunit is crucial for its activation by carbon monoxide.
21078868 2010 Relative motion of transmembrane segments S0 and S4 during voltage sensor activation in the human BK(Ca) channel.
21072171 2010 The regulation of miRNA-211 expression and its role in melanoma cell invasiveness.
20959415 2010 Thromboxane A2 receptor and MaxiK-channel intimate interaction supports channel trans-inhibition independent of G-protein activation.
20808839 2010 Calcium-activated potassium channels BK and IK1 are functionally expressed in human gliomas but do not regulate cell proliferation.
20693285 2010 Palmitoylation of the S0-S1 linker regulates cell surface expression of voltage- and calcium-activated potassium (BK) channels.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20630939 2010 Regulation of podocyte BK(Ca) channels by synaptopodin, Rho, and actin microfilaments.
20624858 2010 The RCK1 domain of the human BKCa channel transduces Ca2+ binding into structural rearrangements.
20613726 2010 LRRC26 auxiliary protein allows BK channel activation at resting voltage without calcium.
20574420 2010 Structure of the gating ring from the human large-conductance Ca(2+)-gated K(+) channel.
20508092 2010 Structure of the human BK channel Ca2+-activation apparatus at 3.0 A resolution.
20479001 2010 Membrane trafficking of large conductance calcium-activated potassium channels is regulated by alternative splicing of a transplantable, acidic trafficking motif in the RCK1-RCK2 linker.
20457834 2010 Activation of BKCa channel is associated with increased apoptosis of cerebrovascular smooth muscle cells in simulated microgravity rats.
20430843 2010 Characterizing the role of Thr352 in the inhibition of the large conductance Ca2+-activated K+ channels by 1-[1-hexyl-6-(methyloxy)-1H-indazol-3-yl]-2-methyl-1-propanone.
20427280 2010 Identification of a thiol/disulfide redox switch in the human BK channel that controls its affinity for heme and CO.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20400778 2010 Genomic variation associated with mortality among adults of European and African ancestry with heart failure: the cohorts for heart and aging research in genomic epidemiology consortium.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20051533 2010 Dominant-negative regulation of cell surface expression by a pentapeptide motif at the extreme COOH terminus of an Slo1 calcium-activated potassium channel splice variant.
20037152 2010 Zn2+ activates large conductance Ca2+-activated K+ channel via an intracellular domain.
20012488 2010 Activation of cloned BK(Ca) channels in nitric oxide-induced apoptosis of HEK293 cells.
19738431 2009 Modulation of KCa channels increases anticancer drug delivery to brain tumors and prolongs survival in xenograft model.
19718020 2009 Structure of the BK potassium channel in a lipid membrane from electron cryomicroscopy.
19640305 2009 Role of KCNMA1 gene in breast cancer invasion and metastasis to brain.
19617704 Comparative effects of H+ and Ca2+ on large-conductance Ca2+- and voltage-gated Slo1 K+ channels.
19552602 2009 Activation of the BK(Ca) channel increases outflow facility and decreases trabecular meshwork cell volume.
19482008 2009 Stress-Axis Regulated Exon (STREX) in the C terminus of BK(Ca) channels is responsible for the stretch sensitivity.
19456106 2009 Solution structure of the HsapBK K+ channel voltage-sensor paddle sequence.
19430934 2009 Coexpression and characterization of the human large-conductance Ca(2+)-activated K (+) channel alpha + beta1 subunits in HEK293 cells.
19344525 2009 Expression of the calcium-activated potassium channel in upper and lower segment human myometrium during pregnancy and parturition.
19204046 2009 {beta} subunit-specific modulations of BK channel function by a mutation associated with epilepsy and dyskinesia.
19168436 2009 TRPC1 associates with BK(Ca) channel to form a signal complex in vascular smooth muscle cells.
19118164 2009 Nardilysin convertase regulates the function of the maxi-K channel isoform mK44 in human myometrium.
19096717 2008 Voltage-dependent Ca2+ channels, not ryanodine receptors, activate Ca2+-dependent BK potassium channels in human retinal pigment epithelial cells.
19052171 2009 Canonical transient receptor potential channel (TRPC)3 and TRPC6 associate with large-conductance Ca2+-activated K+ (BKCa) channels: role in BKCa trafficking to the surface of cultured podocytes.
18854754 2008 Genetic variation in the KCNMA1 potassium channel alpha subunit as risk factor for severe essential hypertension and myocardial infarction.
18719396 A mutually exclusive alternative exon of slo1 codes for a neuronal BK channel with altered function.
18559348 2008 Structural basis for toxin resistance of beta4-associated calcium-activated potassium (BK) channels.
18480178 2008 Nephrin binds to the COOH terminus of a large-conductance Ca2+-activated K+ channel isoform and regulates its expression on the cell surface.
18458941 2008 Functional coupling of TRPV4 cationic channel and large conductance, calcium-dependent potassium channel in human bronchial epithelial cell lines.
18414909 2008 Dysregulation of large-conductance Ca2+-activated K+ channel expression in nonsyndromal mental retardation due to a cereblon p.R419X mutation.
18404672 2008 Silencing of hSlo potassium channels in human osteosarcoma cells promotes tumorigenesis.
18385281 2008 NO-induced regulation of human trabecular meshwork cell volume and aqueous humor outflow facility involve the BKCa ion channel.
18367663 2008 Insulin increases the activity of mesangial BK channels through MAPK signaling.
18345016 2008 Reciprocal regulation of the Ca2+ and H+ sensitivity in the SLO1 BK channel conferred by the RCK1 domain.
18316727 2008 The RCK1 high-affinity Ca2+ sensor confers carbon monoxide sensitivity to Slo1 BK channels.
18227273 2008 Intrinsic electrostatic potential in the BK channel pore: role in determining single channel conductance and block.
18180950 2008 A structural motif in the C-terminal tail of slo1 confers carbon monoxide sensitivity to human BK Ca channels.
18162557 2008 The RCK2 domain of the human BKCa channel is a calcium sensor.
18084004 2008 Acute alcohol tolerance is intrinsic to the BKCa protein, but is modulated by the lipid environment.
17989352 2008 A novel actin-binding domain on Slo1 calcium-activated potassium channels is necessary for their expression in the plasma membrane.
17901123 2007 Human cutaneous reactive hyperaemia: role of BKCa channels and sensory nerves.
17706472 2007 Expression of human BK ion channels in Sf9 cells, their purification using metal affinity chromatography, and functional reconstitution into planar lipid bilayers.
17591990 2007 Modes of operation of the BKCa channel beta2 subunit.
17591987 2007 Saturation and microsecond gating of current indicate depletion-induced instability of the MaxiK selectivity filter.
17586600 2007 Interactions with filamin A stimulate surface expression of large-conductance Ca2+-activated K+ channels in the absence of direct actin binding.
17521822 2007 Endocytic trafficking signals in KCNMB2 regulate surface expression of a large conductance voltage and Ca(2+)-activated K+ channel.
17483867 2006 Contribution of BK(Ca)-channel activity in human cardiac fibroblasts to electrical coupling of cardiomyocytes-fibroblasts.
17468961 2006 Gating and conductance changes in BK(Ca) channels in bilayers are reciprocal.
17166942 2007 RACK1 is a BKCa channel binding protein.
17150299 2007 Diabetes-induced changes in the alternative splicing of the slo gene in corporal tissue.
17146446 2007 KCNMA1 gene amplification promotes tumor cell proliferation in human prostate cancer.
16951373 2006 MaxiK blockade selectively inhibits the lipopolysaccharide-induced I kappa B-alpha /NF-kappa B signaling pathway in macrophages.
16895996 2006 Voltage-dependent conformational changes in human Ca(2+)- and voltage-activated K(+) channel, revealed by voltage-clamp fluorometry.
16790810 2006 Cell activation by ligands of the toll-like receptor and interleukin-1 receptor family depends on the function of the large-conductance potassium channel MaxiK in human macrophages.
16396928 2006 Three methionine residues located within the regulator of conductance for K+ (RCK) domains confer oxidative sensitivity to large-conductance Ca2+-activated K+ channels.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16382103 2005 International Union of Pharmacology. LII. Nomenclature and molecular relationships of calcium-activated potassium channels.
16100257 2005 Homology modeling identifies C-terminal residues that contribute to the Ca2+ sensitivity of a BKCa channel.
16042390 2005 Role of the C-terminus of the high-conductance calcium-activated potassium channel in channel structure and function.
15937479 2005 Calcium-sensitive potassium channelopathy in human epilepsy and paroxysmal movement disorder.
15849354 2005 Distinct structural features of phospholipids differentially determine ethanol sensitivity and basal function of BK channels.
15703204 2005 Maxi-K channels localize to caveolae in human myometrium: a role for an actin-channel-caveolin complex in the regulation of myometrial smooth muscle K+ current.
15528406 2004 Hemoxygenase-2 is an oxygen sensor for a calcium-sensitive potassium channel.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15280542 2004 Distinct stoichiometry of BKCa channel tetramer phosphorylation specifies channel activation and inhibition by cAMP-dependent protein kinase.
15194822 2004 Extracellular ATP induces oscillations of intracellular Ca2+ and membrane potential and promotes transcription of IL-6 in macrophages.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14715246 2004 siRNA knock-down of gamma-glutamyl transpeptidase does not affect hypoxic K+ channel inhibition.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14631046 2003 Abnormal coronary function in mice deficient in alpha1H T-type Ca2+ channels.
14584897 2003 Focal adhesion kinase pp125FAK interacts with the large conductance calcium-activated hSlo potassium channel in human osteoblasts: potential role in mechanotransduction.
14523450 2003 Haem can bind to and inhibit mammalian calcium-dependent Slo1 BK channels.
14522958 2003 Post-transcriptional control of human maxiK potassium channel activity and acute oxygen sensitivity by chronic hypoxia.
12566537 2003 Gating mechanism of BK (Slo1) channels: so near, yet so far.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438308 2003 The cytoplasmic tail of large conductance, voltage- and Ca2+-activated K+ (MaxiK) channel is necessary for its cell surface expression.
12434576 2002 Calcium-activated potassium channel expression in human myometrium: effect of pregnancy.
12391293 2002 Coupling of c-Src to large conductance voltage- and Ca2+-activated K+ channels as a new mechanism of agonist-induced vasoconstriction.
12388065 2002 Maxi K+ channel mediates regulatory volume decrease response in a human bronchial epithelial cell line.
12223479 2002 Reciprocal modulation between the alpha and beta 4 subunits of hSlo calcium-dependent potassium channels.
12161564 2002 Stepwise contribution of each subunit to the cooperative activation of BK channels by Ca2+.
12009018 2002 Prostaglandin E2 induces interaction between hSlo potassium channel and Syk tyrosine kinase in osteosarcoma cells.
11986367 2002 Hypoxia inhibits human recombinant large conductance, Ca(2+)-activated K(+) (maxi-K) channels by a mechanism which is membrane delimited and Ca(2+) sensitive.
11880513 2002 Cloning and characterization of glioma BK, a novel BK channel isoform highly expressed in human glioma cells.
11880485 2002 Consequences of the stoichiometry of Slo1 alpha and auxiliary beta subunits on functional properties of large-conductance Ca2+-activated K+ channels.
11641143 2001 Bladder injection of "naked" hSlo/pcDNA3 ameliorates detrusor hyperactivity in obstructed rats in vivo.
11604135 2001 Identification of a novel tetramerization domain in large conductance K(ca) channels.
11401860 2001 Characterization of a novel 132-bp exon of the human maxi-K channel.
11245614 2001 Activation of K+ channels induces apoptosis in vascular smooth muscle cells.
10840032 2000 Characterization and gene expression of high conductance calcium-activated potassium channels displaying mechanosensitivity in human odontoblasts.
10692449 2000 Cloning and functional characterization of novel large conductance calcium-activated potassium channel beta subunits, hKCNMB3 and hKCNMB4.
10489376 1999 Acute activation of Maxi-K channels (hSlo) by estradiol binding to the beta subunit.
10097176 1999 Molecular basis of fast inactivation in voltage and Ca2+-activated K+ channels: a transmembrane beta-subunit homolog.
9829973 1998 Role of the S4 segment in a voltage-dependent calcium-sensitive potassium (hSlo) channel.
9391153 1997 Large conductance voltage- and calcium-dependent K+ channel, a distinct member of voltage-dependent ion channels with seven N-terminal transmembrane segments (S0-S6), an extracellular N terminus, and an intracellular (S9-S10) C terminus.
8962157 1996 Determinant for beta-subunit regulation in high-conductance voltage-activated and Ca(2+)-sensitive K+ channels: an additional transmembrane region at the N terminus.
8821792 1995 Characterization of and modulation by a beta-subunit of a human maxi KCa channel cloned from myometrium.
8612769 1996 A calcium switch for the functional coupling between alpha (hslo) and beta subunits (KV,Ca beta) of maxi K channels.
8006036 1994 Primary sequence and immunological characterization of beta-subunit of high conductance Ca(2+)-activated K+ channel from smooth muscle.
7993625 1994 Cloning, expression, and distribution of functionally distinct Ca(2+)-activated K+ channel isoforms from human brain.
7987297 1994 Cloning and characterization of human and mouse homologs of the Drosophila calcium-activated potassium channel gene, slowpoke.
7877450 1994 Cloning and expression of a human large-conductance calcium-activated potassium channel.
7687074 1993 mSlo, a complex mouse gene encoding "maxi" calcium-activated potassium channels.
7573516 1995 A human calcium-activated potassium channel gene expressed in vascular smooth muscle.