Property Summary

NCBI Gene PubMed Count 73
PubMed Score 120.78
PubTator Score 151.60

Knowledge Summary

Patent (2,592)

TINX Plot

  Disease (8)

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic -1.100 1.4e-02
ependymoma -1.500 2.8e-06
glioblastoma -1.100 5.2e-03
group 3 medulloblastoma -2.100 8.7e-03
osteosarcoma 1.041 1.6e-04
ovarian cancer 1.400 1.7e-09
subependymal giant cell astrocytoma -2.025 1.7e-02

Gene RIF (44)

AA Sequence

MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSE      1 - 70
PHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLL     71 - 140
KRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQT    141 - 210
KGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPR    211 - 280
PSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSP    281 - 350
ISSISPGLHSFTDHQRLMKRRKSV                                                  351 - 374
//

Text Mined References (73)

PMID Year Title