Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.31
PubTator Score 2.04

Knowledge Summary

Patent (1,498)

TINX Plot

  Disease (1)

Disease Target Count P-value
cutaneous lupus erythematosus 1016 9.0e-03

Expression

  Differential Expression (1)

Disease log2 FC p
cutaneous lupus erythematosus -1.400 9.0e-03

AA Sequence

MGGLRPWSRYGLLVVAHLLALGLGAVVFQALEGPPACRLQAELRAELAAFQAEHRACLPPGALEELLGTA      1 - 70
LATQAHGVSTLGNSSEGRTWDLPSALLFAASILTTTGYGHMAPLSPGGKAFCMVYAALGLPASLALVATL     71 - 140
RHCLLPVLSRPRAWVAVHWQLSPARAALLQAVALGLLVASSFVLLPALVLWGLQGDCSLLGAVYFCFSSL    141 - 210
STIGLEDLLPGRGRSLHPVIYHLGQLALLGYLLLGLLAMLLAVETFSELPQVRAMGKFFRPSGPVTAEDQ    211 - 280
GGILGQDELALSTLPPAAPASGQAPAC                                               281 - 307
//

Text Mined References (7)

PMID Year Title