Property Summary

NCBI Gene PubMed Count 16
PubMed Score 334.37
PubTator Score 15.54

Knowledge Summary

Patent (4,115)

Expression

  Differential Expression (9)

Gene RIF (4)

PMID Text
22944692 Positional proteomics analysis identifies the cleavage of human potassium channel, subfamily K, member 6 (KCNK6) at amino acid residues 42-43 by the HIV-1 protease
21964404 Potassium channels, in particular K2P channels, are expressed and functional in the apical membrane of airway epithelial cells
20029952 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
14689445 Identification and characterization of Kcnk6 expression within the mammalian cochlea established the gene as a functional candidate for DFNA4.

AA Sequence

MRRGALLAGALAAYAAYLVLGALLVARLEGPHEARLRAELETLRAQLLQRSPCVAAPALDAFVERVLAAG      1 - 70
RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGKAFSIAFALLGVPTTMLLLTA     71 - 140
SAQRLSLLLTHVPLSWLSMRWGWDPRRAACWHLVALLGVVVTVCFLVPAVIFAHLEEAWSFLDAFYFCFI    141 - 210
SLSTIGLGDYVPGEAPGQPYRALYKVLVTVYLFLGLVAMVLVLQTFRHVSDLHGLTELILLPPPCPASFN    211 - 280
ADEDDRVDILGPQPESHQQLSASSHTDYASIPR                                         281 - 313
//

Text Mined References (16)

PMID Year Title
21964404 2012 A role for two-pore K? channels in modulating Na? absorption and Cl? secretion in normal human bronchial epithelial cells.
20029952 2010 Genetic modifiers of the severity of sickle cell anemia identified through a genome-wide association study.
18516069 2008 Regulation of two-pore-domain (K2P) potassium leak channels by the tyrosine kinase inhibitor genistein.
16382106 2005 International Union of Pharmacology. LV. Nomenclature and molecular relationships of two-P potassium channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14689445 2004 Genomic structure, cochlear expression, and mutation screening of KCNK6, a candidate gene for DFNA4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256078 2001 Potassium leak channels and the KCNK family of two-P-domain subunits.
10887187 2000 TWIK-2, an inactivating 2P domain K+ channel.
10393428 1999 Assignment of KCNK6 encoding the human weak inward rectifier potassium channel TWIK-2 to chromosome band 19q13.1 by radiation hybrid mapping.
10359073 1999 Identification and cloning of TWIK-originated similarity sequence (TOSS): a novel human 2-pore K+ channel principal subunit.
10206991 1999 Cloning of a new mouse two-P domain channel subunit and a human homologue with a unique pore structure.
10075682 1999 TWIK-2, a new weak inward rectifying member of the tandem pore domain potassium channel family.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1088718 1976 Intramural duodenal hematoma in children. The role of the radiologist in its conservative management.