Property Summary

Ligand Count 108
NCBI Gene PubMed Count 58
PubMed Score 291.12
PubTator Score 4098.25

Knowledge Summary

Patent (9,414)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Familial primary pulmonary hypertension 11 0.0 0.0
Gliosis 56 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (22)

Protein-protein Interaction (1)

Gene RIF (53)

AA Sequence

MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPELIERQRLELRQQELRARYNLSQGGYEELERVVLRLK      1 - 70
PHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPLTLVMFQSLGERINTLVRYLL     71 - 140
HRAKKGLGMRRADVSMANMVLIGFFSCISTLCIGAAAFSHYEHWTFFQAYYYCFITLTTIGFGDYVALQK    141 - 210
DQALQTQPQYVAFSFVYILTGLTVIGAFLNLVVLRFMTMNAEDEKRDAEHRALLTRNGQAGGGGGGGSAH    211 - 280
TTDTASSTAAAGGGGFRNVYAEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGG    281 - 350
GRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGLMKRRSSV                              351 - 394
//

Text Mined References (59)

PMID Year Title