Property Summary

NCBI Gene PubMed Count 24
PubMed Score 72.36
PubTator Score 46.75

Knowledge Summary

Patent (15,059)

Expression

  Differential Expression (27)

Disease log2 FC p
malignant mesothelioma 2.400 4.2e-08
astrocytic glioma -3.100 2.4e-03
ependymoma -4.200 1.5e-13
oligodendroglioma -2.600 1.4e-19
glioblastoma -4.700 6.5e-07
medulloblastoma -3.200 1.9e-04
cystic fibrosis 3.112 6.5e-07
atypical teratoid / rhabdoid tumor -4.400 5.2e-11
medulloblastoma, large-cell -4.200 1.0e-05
primitive neuroectodermal tumor -4.000 6.3e-04
pancreatic ductal adenocarcinoma liver m... 1.957 3.8e-02
non-small cell lung cancer 1.555 2.5e-13
intraductal papillary-mucinous adenoma (... 3.000 8.5e-04
intraductal papillary-mucinous carcinoma... 2.500 4.4e-03
intraductal papillary-mucinous neoplasm ... 2.500 1.8e-02
lung cancer -2.700 3.2e-05
Parkinson's disease -1.400 8.7e-03
pancreatic cancer 2.000 2.6e-06
pediatric high grade glioma -4.000 4.3e-07
pilocytic astrocytoma -1.400 3.8e-03
subependymal giant cell astrocytoma -5.089 3.8e-04
lung adenocarcinoma 1.652 5.4e-05
spina bifida -2.127 3.7e-02
ductal carcinoma in situ 2.000 2.2e-02
invasive ductal carcinoma 2.200 9.0e-03
ovarian cancer -1.300 4.3e-03
pituitary cancer -1.400 3.5e-04

Gene RIF (8)

PMID Text
25001086 TWIK-1 protein possesses a hydrophobic barrier deep within the inner pore
22282804 study presents the 3.4 angstrom resolution crystal structure of a human K2P channel, K2P1; an extracellular cap domain located above the selectivity filter forms an ion pathway in which K(+) ions flow through side portals
21964404 Potassium channels, in particular K2P channels, are expressed and functional in the apical membrane of airway epithelial cells
21653227 ion selectivity of TWIK-1 K+ channels during pathological hypokalemia; a molecular basis for inward leak Na+ currents that could trigger or contribute to cardiac paradoxical depolarization in lowered [K+]o; mechanism for regulating cardiac excitability.
19959478 TWIK1 is internalized via a dynamin-dependent mechanism and addressed to the recycling endosomal compartment. Mutation in its cytoplasmic C terminus (I293A,I294A) stabilizes TWIK1 at the plasma membrane, resulting in robust currents.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19571146 support TWIK-1 and TREK-1 as being the major components of the long-sought K(+) channels underlying the passive conductance of mature hippocampal astrocytes
15820677 Removal of the peptide adduct by SUMO protease reveals K2P1 to be a K+-selective, pH-sensitive, openly rectifying channel regulated by reversible peptide linkage.

AA Sequence

MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLKRRFLEEHECL      1 - 70
SEQQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVI     71 - 140
GIPFTLLFLTAVVQRITVHVTRRPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDW    141 - 210
NFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMF    211 - 280
YVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH                  281 - 336
//

Text Mined References (33)

PMID Year Title
25530075 2015 The family of K2P channels: salient structural and functional properties.
25339226 2015 Silent but not dumb: how cellular trafficking and pore gating modulate expression of TWIK1 and THIK2.
25001086 2014 A hydrophobic barrier deep within the inner pore of the TWIK-1 K2P potassium channel.
23169818 2012 SUMOylation silences heterodimeric TASK potassium channels containing K2P1 subunits in cerebellar granule neurons.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
22431633 2012 TWIK1, a unique background channel with variable ion selectivity.
22282804 2012 Crystal structure of the human two-pore domain potassium channel K2P1.
21964404 2012 A role for two-pore K? channels in modulating Na? absorption and Cl? secretion in normal human bronchial epithelial cells.
21653227 2011 TWIK-1 two-pore domain potassium channels change ion selectivity and conduct inward leak sodium currents in hypokalemia.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
20498050 2010 One SUMO is sufficient to silence the dimeric potassium channel K2P1.
19959478 2010 Potassium channel silencing by constitutive endocytosis and intracellular sequestration.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19571146 2009 TWIK-1 and TREK-1 are potassium channels contributing significantly to astrocyte passive conductance in rat hippocampal slices.
17693262 2007 Does sumoylation control K2P1/TWIK1 background K+ channels?
17478540 2007 Regional and tissue specific transcript signatures of ion channel genes in the non-diseased human heart.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16382106 2005 International Union of Pharmacology. LV. Nomenclature and molecular relationships of two-P potassium channels.
15820677 2005 Sumoylation silences the plasma membrane leak K+ channel K2P1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12855359 2003 Cellular localization of TWIK-1, a two-pore-domain potassium channel in the rodent inner ear.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256078 2001 Potassium leak channels and the KCNK family of two-P-domain subunits.
11165377 2001 Distribution analysis of human two pore domain potassium channels in tissues of the central nervous system and periphery.
11053038 2000 Molecular and functional properties of two-pore-domain potassium channels.
9832487 1998 Differential distribution of inward rectifier potassium channel transcripts in human atrium versus ventricle.
9462864 1998 Sequence and function of the two P domain potassium channels: implications of an emerging superfamily.
9362344 1997 Cloning and localization of a double-pore K channel, KCNK1: exclusive expression in distal nephron segments.
8978667 1996 Dimerization of TWIK-1 K+ channel subunits via a disulfide bridge.
8661042 1996 Assignment of the human weak inward rectifier K+ channel TWIK-1 gene to chromosome 1q42-q43.
8605869 1996 TWIK-1, a ubiquitous human weakly inward rectifying K+ channel with a novel structure.