Property Summary

NCBI Gene PubMed Count 34
PubMed Score 80.15
PubTator Score 71.20

Knowledge Summary

Patent (3,262)

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.800 1.1e-03
ependymoma -3.500 4.8e-04
oligodendroglioma -2.600 6.0e-03
glioblastoma -3.500 2.3e-05
medulloblastoma -2.700 7.5e-04
atypical teratoid / rhabdoid tumor -2.800 5.0e-06
medulloblastoma, large-cell -3.300 4.5e-03
primitive neuroectodermal tumor -2.700 8.8e-03
pediatric high grade glioma -2.500 3.3e-03
pilocytic astrocytoma -3.100 2.1e-04
Pick disease -1.100 6.9e-03
pituitary cancer -1.300 4.1e-07
psoriasis -1.200 3.0e-08

Protein-protein Interaction (1)

Gene RIF (9)

PMID Text
22396414 Increased excitability and decreased dendritic arborization are associated with downregulation of inward rectifier potassium channels (Kir2.1/2.3).
20424473 Observational study of gene-disease association. (HuGE Navigator)
19635485 TIP-1 may act as an important regulator for the endocytic pathway of Kir2.3.
18503768 The data suggest that Kir2.3 plays a potentially important role in I(K1) currents in neonatal rat cardiomyocytes.
18453743 possibility of intramolecular interactions of the residue Kir2.3(H117) with conserved cysteines in close proximity to the selectivity filter
18180291 Kir2.3 is internalized by an AP-2 clathrin-dependent mechanism.
16373386 In conclusion, the data are consistent with the universal mechanism of rectification in Kir2 channels, but also point to significant, and physiologically important, quantitative differences between Kir2 isoforms.
16258766 Results describe the regulation of inwardly rectifying potassium current and its main molecular correlates, Kir2.1, Kir2.2 and Kir2.3 channels, by endothelin-1 in human atrial cardiomyocytes.
15958527 Kir2.2 and Kir2.1 are primary determinants of endogenous K(+) conductance in HAECs under resting conditions and that Kir2.2 provides the dominant conductance in these cells.

AA Sequence

MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLMIFSAAFLVSW      1 - 70
LFFGLLFWCIAFFHGDLEASPGVPAAGGPAAGGGGAAPVAPKPCIMHVNGFLGAFLFSVETQTTIGYGFR     71 - 140
CVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKRAQTLLFSHHAVISVRDGKLCLMWRVGNLR    141 - 210
KSHIVEAHVRAQLIKPYMTQEGEYLPLDQRDLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELE    211 - 280
SEDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSA    281 - 350
RELQESKITVLPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFG    351 - 420
SHLDLERMQASLPLDNISYRRESAI                                                 421 - 445
//

Text Mined References (35)

PMID Year Title
24800985 2014 Genome-wide association study of maternal and inherited loci for conotruncal heart defects.
22396414 2012 Striatal D2 receptors regulate dendritic morphology of medium spiny neurons via Kir2 channels.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
19635485 2009 Molecular mechanism of inward rectifier potassium channel 2.3 regulation by tax-interacting protein-1.
18503768 2008 Kir2.3 knock-down decreases IK1 current in neonatal rat cardiomyocytes.
18453743 2008 Novel insights into the structural basis of pH-sensitivity in inward rectifier K+ channels Kir2.3.
18391953 2008 Rare independent mutations in renal salt handling genes contribute to blood pressure variation.
18180291 2008 AP-2-dependent internalization of potassium channel Kir2.3 is driven by a novel di-hydrophobic signal.
17185339 2007 Evidence for association of GABA(B) receptors with Kir3 channels and regulators of G protein signalling (RGS4) proteins.
16855024 2006 TIP-1 has PDZ scaffold antagonist activity.
16382105 2005 International Union of Pharmacology. LIV. Nomenclature and molecular relationships of inwardly rectifying potassium channels.
16373386 2006 Differential polyamine sensitivity in inwardly rectifying Kir2 potassium channels.
16258766 2006 Regulation of cardiac inwardly rectifying potassium current IK1 and Kir2.x channels by endothelin-1.
15958527 2005 Functional expression of Kir2.x in human aortic endothelial cells: the dominant role of Kir2.2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15024025 2004 Protein trafficking and anchoring complexes revealed by proteomic analysis of inward rectifier potassium channel (Kir2.x)-associated proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12032359 2002 Heteromerization of Kir2.x potassium channels contributes to the phenotype of Andersen's syndrome.
11997254 2002 Inward rectifier K+ channel Kir2.3 is localized at the postsynaptic membrane of excitatory synapses.
11742811 2002 Basolateral membrane expression of the Kir 2.3 channel is coordinated by PDZ interaction with Lin-7/CASK complex.
11713246 2002 Transforming growth factor-beta 1 regulates Kir2.3 inward rectifier K+ channels via phospholipase C and protein kinase C-delta in reactive astrocytes from adult rat brain.
11306688 2001 Direct activation of an inwardly rectifying potassium channel by arachidonic acid.
11181181 2001 Inward rectifier potassium channel Kir2.2 is associated with synapse-associated protein SAP97.
10627592 2000 Neuronal inwardly rectifying K(+) channels differentially couple to PDZ proteins of the PSD-95/SAP90 family.
10591208 1999 The DNA sequence of human chromosome 22.
10479680 1999 Neuronal interleukin-16 (NIL-16): a dual function PDZ domain protein.
10206975 1999 Suppression of Kir2.3 activity by protein kinase C phosphorylation of the channel protein at threonine 53.
8943291 1996 Inhibition of an inward rectifier potassium channel (Kir2.3) by G-protein betagamma subunits.
8893032 1996 Binding of the inward rectifier K+ channel Kir 2.3 to PSD-95 is regulated by protein kinase A phosphorylation.
8051145 1994 Cloning and expression of a novel human brain inward rectifier potassium channel.
8034048 1994 Cloning a novel human brain inward rectifier potassium channel and its functional expression in Xenopus oocytes.
8016146 1994 Primary structure and characterization of a small-conductance inwardly rectifying potassium channel from human hippocampus.
7607694 1995 Assignment of the human hippocampal inward rectifier potassium channel (HIR) gene to 22q13.1.
7576658 1995 Identification and molecular localization of a pH-sensing domain for the inward rectifier potassium channel HIR.