Property Summary

NCBI Gene PubMed Count 40
PubMed Score 205.47
PubTator Score 114.15

Knowledge Summary

Patent (12,933)

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -2.600 4.7e-03
ependymoma -2.100 1.5e-02
oligodendroglioma -2.600 1.4e-16
glioblastoma -5.200 2.3e-08
medulloblastoma -4.300 2.9e-07
non diabetic and post-ischemic heart fai... 1.200 2.9e-02
type II diabetes mellitus and post-ische... 1.400 2.3e-02
atypical teratoid / rhabdoid tumor -4.900 5.9e-08
medulloblastoma, large-cell -4.000 4.0e-04
primitive neuroectodermal tumor -4.100 4.6e-05
active ulcerative colitis 2.268 9.7e-03
pediatric high grade glioma -4.300 4.9e-08
pilocytic astrocytoma -4.900 5.0e-11
subependymal giant cell astrocytoma -3.311 2.8e-03
lung carcinoma 1.500 2.7e-06
pituitary cancer -1.300 1.4e-02
psoriasis -1.800 9.0e-25

Protein-protein Interaction (1)

Gene RIF (19)

PMID Text
25599232 The findings of this study suggest that variations in KCNJ3 genes are associated with both mild and severe persistent breast pain after breast cancer surgery.
24392765 For KCNJ3 rs7574878, individuals who were heterozygous or homozygous for the rare G allele (TT versus TG+ GG) had a 48% reduction in the odds of reporting preoperative breast pain.
23368630 we show that Kir3.1, in the absence of trafficking partner subunits, can exit the endoplasmic reticulum (ER) and reach the Golgi (though not the plasma membrane)
23219908 In the dorsal horn of the developing rat, K(ir)3.1 and K(ir)3.2 were expressed at mature levels from birth.
23175530 Conformational changes at the Gbetagamma/Kir3 interface were lost when Kir3.1 subunits were replaced.
21927946 These data suggest that the KCNJ3 gene is genetically associated with schizophrenia in Asian populations and add further evidence to the "channelopathy theory of psychiatric illnesses".
21420934 Kir3.1 channel is involved in the TLR4-mediated signal at an early event by facilitating the recruitment of TLR4 into lipid raft.
21044958 halothane predominantly interferes with Gbetagamma-mediated Kir3 currents, such as those functioning during inhibitory synaptic activity
20512921 The very high abundance of mRNA's encoding GIRK1 together with the presence of GIRK1 protein suggests a pathophysiological role in breast cancer
20468064 Observational study of gene-disease association. (HuGE Navigator)
20110696 We identified several known single nucleotide polymorphisms in KCNJ3 and KCNJ5, but no mutations in either of the genes.
20110696 Observational study of gene-disease association. (HuGE Navigator)
19151997 S385 identified as in vitro phosphorylation site. Mutation of this residue to alanine resulted in reduced sensitivity of Kir3.1* currents to H89 & Forskolin, confirming in vivo role for this novel site of the Kir3.1 channel subunit in regulation by PKA.
19135528 Sar 1 H79G and Rab 1 S25N mutants efficiently blocked the plasma membrane trafficking of the Kir3.1/Kir3.4 complex however they did not block the Gbeta1gamma2/Kir3.1 interaction. Gbeta1-4 can interact with Kir3.1 in the absence of Kir3.4.
18498071 GIRK1 was overexpressed in breast carcinoma suggesting its involvement in proliferation and oncogenesis and its possible use as a putative pharmaceutical target.
16109170 GIRK1 and GIRK2 channels, but not GIRK3 or GIRK4, may may activate signaling pathways in development of lung cancer
15142872 that GIRK channels are important functional effectors of the P2Y(12) receptor in human platelets.
12458027 Observational study of gene-disease association. (HuGE Navigator)
12034888 glutamate residue at the C terminus regulates activity -- implications for Andersen Disease (inward rectifier potassium channel 2; IRK2)

AA Sequence

MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNLGSETSRYLSD      1 - 70
LFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNYTPCVANVYNFPSAFLFFIET     71 - 140
EATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCMFIKMSQPKKRAETLMFSEHAVISMRDGKLT    141 - 210
LMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPF    211 - 280
YDLSQRSMQTEQFEIVVILEGIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFE    281 - 350
VPTPPYSVKEQEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDITTKLPSKLQKITGREDFPKKLLRMS    351 - 420
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGAARMEGNLPA    421 - 490
KLRKMNSDRFT                                                               491 - 501
//

Text Mined References (42)

PMID Year Title
25599232 2015 Variations in potassium channel genes are associated with distinct trajectories of persistent breast pain after breast cancer surgery.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24392765 Variations in potassium channel genes are associated with breast pain in women prior to breast cancer surgery.
23368630 2013 A novel, radiolabel-free pulse chase strategy to study Kir3 channel ontogeny.
23219908 2013 Transcriptional expression of voltage-gated Na? and voltage-independent K? channels in the developing rat superficial dorsal horn.
23175530 2013 Conformational dynamics of Kir3.1/Kir3.2 channel activation via ?-opioid receptors.
21927946 2012 Association study of the KCNJ3 gene as a susceptibility candidate for schizophrenia in the Chinese population.
21420934 2011 Kir3.1 channel is functionally involved in TLR4-mediated signaling.
21044958 2010 G protein {beta}{gamma} gating confers volatile anesthetic inhibition to Kir3 channels.
20560207 2010 Identification of a Kir3.4 mutation in congenital long QT syndrome.
20512921 2010 Cloning and characterisation of GIRK1 variants resulting from alternative RNA editing of the KCNJ3 gene transcript in a human breast cancer cell line.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20110696 2010 Genetic variation in the inwardly rectifying K channel subunits KCNJ3 (GIRK1) and KCNJ5 (GIRK4) in patients with sinus node dysfunction.
19151997 2009 Mass spectrometric analysis reveals a functionally important PKA phosphorylation site in a Kir3 channel subunit.
19135528 2009 Intracellular trafficking and assembly of specific Kir3 channel/G protein complexes.
18498071 2008 Expression of K+ channels in normal and cancerous human breast.
18391953 2008 Rare independent mutations in renal salt handling genes contribute to blood pressure variation.
18097938 2007 The GIRK1 brain variant GIRK1d and its functional impact on heteromultimeric GIRK channels.
17185339 2007 Evidence for association of GABA(B) receptors with Kir3 channels and regulators of G protein signalling (RGS4) proteins.
16382105 2005 International Union of Pharmacology. LIV. Nomenclature and molecular relationships of inwardly rectifying potassium channels.
16109170 2005 Expression of G-protein inwardly rectifying potassium channels (GIRKs) in lung cancer cell lines.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15142872 2004 Role of G protein-gated inwardly rectifying potassium channels in P2Y12 receptor-mediated platelet functional responses.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12743112 2003 Mapping the Gbetagamma-binding sites in GIRK1 and GIRK2 subunits of the G protein-activated K+ channel.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12458027 2002 Suggestive evidence for association of two potassium channel genes with different idiopathic generalised epilepsy syndromes.
12297500 2002 G protein-coupled receptors form stable complexes with inwardly rectifying potassium channels and adenylyl cyclase.
12034888 2002 A glutamate residue at the C terminus regulates activity of inward rectifier K+ channels: implication for Andersen's syndrome.
11741896 2002 Identification of critical residues controlling G protein-gated inwardly rectifying K(+) channel activity through interactions with the beta gamma subunits of G proteins.
11345517 2001 Cloning and characterization of G protein-gated inward rectifier K+ channel (GIRK1) isoforms from heart and brain.
10889209 2000 Glycosylation of GIRK1 at Asn119 and ROMK1 at Asn117 has different consequences in potassium channel function.
9891030 1999 GIRK4 confers appropriate processing and cell surface localization to G-protein-gated potassium channels.
9765280 1998 Identification of native atrial G-protein-regulated inwardly rectifying K+ (GIRK4) channel homomultimers.
9119365 1997 Genomic organization and promoter analysis of the human G-protein-coupled K+ channel Kir3.1 (KCNJ3/HGIRK1).
9108307 1997 Binding of the G protein betagamma subunit to multiple regions of G protein-gated inward-rectifying K+ channels.
9023358 1997 Normal cerebellar development but susceptibility to seizures in mice lacking G protein-coupled, inwardly rectifying K+ channel GIRK2.
8929423 1996 Heteromultimerization of G-protein-gated inwardly rectifying K+ channel proteins GIRK1 and GIRK2 and their altered expression in weaver brain.
8868049 1996 A recombinant inwardly rectifying potassium channel coupled to GTP-binding proteins.
8804710 1996 Cloning of a G protein-activated inwardly rectifying potassium channel from human cerebellum.
8088798 1994 Human G-protein-coupled inwardly rectifying potassium channel (GIRK1) gene (KCNJ3): localization to chromosome 2 and identification of a simple tandem repeat polymorphism.