Property Summary

Ligand Count 4
NCBI Gene PubMed Count 142
PubMed Score 224.85
PubTator Score 390.01

Knowledge Summary

Patent (4,865)

TINX Plot

  Disease (8)

Disease Target Count
ATRIAL FIBRILLATION, FAMILIAL, 1 (disorder) 21
Acquired scoliosis 281
Antegonial notching of mandible 2
Bidirectional ventricular ectopy 1
Bilateral fifth finger clinodactyly 110
Blepharophimosis 70
Brachydactyly 156
Broad forehead 59
Bulbous nasal tip 48
Bulbous nose 48
Byzanthine arch palate 194
Cleft Palate 271
Clinodactyly of the 5th toe 6
Curvature of little finger 110
Curvature of spine 282
Curvature of the little toe 6
Decreased projection of maxilla 66
Decreased size of mandibular ramus 2
Defective enamel matrix 35
Deficiency of upper jaw bones 66
Delayed bone age 136
Delayed eruption of permanent teeth 8
Dental Enamel Hypoplasia 43
Depressive disorder 409
Dermatologic disorders 93
Dysplasia of tooth enamel 35
Elevated heart rate 25
Facial asymmetry 32
Failure of exfoliation of primary tooth 8
Hyperplasia of frontal sinus 1
Hypertrophy of frontal sinus 1
Hypoplasia of the maxilla 66
Hypoplastic feet 66
Hypotrophic malar bone 129
Hypotrophic maxilla 66
Increased size of frontal sinus 1
Increased volume of frontal sinus 1
Joint laxity 54
Low set ears 181
Malar flattening 129
Maxillary retrognathia 66
Missing more than six teeth 22
Oligodontia 24
Orbital separation excessive 244
Palpitations 18
Paroxysmal atrial fibrillation 14
Periodic hypokalemic paresis 7
Potato nose 48
Preauricular Fistulae, Congenital 27
Preauricular dimple 27
Preauricular sinus 27
Prolonged QT interval 15
Prominent frontal sinuses 1
Retrusion of upper jaw bones 66
Scapular weakness 23
Short hands 50
Short mandibular rami 2
Short metacarpal 43
Short metatarsal 21
Short palpebral fissure 38
Short phalanx of finger 32
Shortened QT interval 5
Slender, gracile long tubular bones 21
Small hand 36
Small head 374
Syncope 22
Syndactyly of the toes 45
Tachycardia 43
Thin dental enamel 35
Thin upper lip vermilion 67
Triangular face 58
Uranostaphyloschisis 167
Winged scapula 23
abnormal growth 26
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Andersen-Tawil syndrome 8 0.0 5.0
Short QT syndrome 12 0.0 5.0
Disease Target Count Z-score Confidence
Familial atrial fibrillation 23 0.0 4.0
Long QT syndrome 39 0.0 4.0

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma 1.323 7.2e-04
astrocytic glioma -2.800 1.3e-02
Breast cancer -2.300 2.5e-17
cystic fibrosis 1.445 1.1e-05
Down syndrome 1.100 2.2e-03
ductal carcinoma in situ -1.500 5.2e-03
Endometriosis -1.446 1.4e-02
ependymoma -2.900 1.8e-02
gastric cancer 1.400 1.7e-03
hepatocellular carcinoma 2.500 7.2e-06
interstitial cystitis 1.600 4.4e-04
intraductal papillary-mucinous adenoma (... -2.100 7.7e-03
invasive ductal carcinoma -1.400 3.6e-03
lung adenocarcinoma -1.200 2.6e-05
lung cancer 1.600 1.1e-04
malignant mesothelioma 1.800 4.7e-07
oligodendroglioma -2.400 2.4e-02
ovarian cancer -2.500 7.2e-07
pancreatic cancer 2.100 1.8e-04
pancreatic carcinoma 2.100 1.8e-04
primitive neuroectodermal tumor -1.600 4.7e-04
psoriasis 1.200 8.1e-70
sarcoidosis 1.400 3.1e-02
sonic hedgehog group medulloblastoma -1.900 2.2e-04
tuberculosis -2.100 9.6e-04
ulcerative colitis -1.200 1.2e-02

Gene RIF (109)

AA Sequence

MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFINVGEKGQRYLA      1 - 70
DIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKEGKACVSEVNSFTAAFLFSIETQ     71 - 140
TTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVMAKMAKPKKRNETLVFSHNAVIAMRDGKLCL    141 - 210
MWRVGNLRKSHLVEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLY    211 - 280
DLSKQDIDNADFEIVVILEGMVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEV    281 - 350
PNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRP    351 - 420
LRRESEI                                                                   421 - 427
//

Text Mined References (141)

PMID Year Title