Property Summary

NCBI Gene PubMed Count 26
PubMed Score 20.99
PubTator Score 19.20

Knowledge Summary

Patent (2,304)

Expression

  Differential Expression (22)

Disease log2 FC p
Atopic dermatitis 1.100 1.1e-02
chronic rhinosinusitis 1.082 4.0e-02
cutaneous lupus erythematosus 1.500 6.0e-03
cystic fibrosis and chronic rhinosinusit... 1.279 1.6e-02
gastric carcinoma -2.100 2.0e-02
head and neck cancer 1.200 4.9e-02
interstitial cystitis -2.400 8.3e-04
intraductal papillary-mucinous carcinoma... -3.600 2.4e-03
lung adenocarcinoma -1.700 5.2e-08
lung cancer -4.500 5.0e-05
lung carcinoma -4.100 1.0e-40
malignant mesothelioma -3.800 3.6e-08
mucosa-associated lymphoid tissue lympho... 1.373 1.8e-02
nephrosclerosis -1.668 2.7e-02
non-small cell lung cancer -1.214 1.4e-07
osteosarcoma -2.514 2.1e-02
ovarian cancer -1.100 2.6e-04
pancreatic cancer 1.600 7.4e-03
pancreatic carcinoma 1.600 7.4e-03
psoriasis 1.400 4.2e-06
tuberculosis -1.600 1.2e-02
ulcerative colitis 2.000 2.4e-03

Protein-protein Interaction (1)

Gene RIF (11)

AA Sequence

MDAIHIGMSSTPLVKHTAGAGLKANRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVIDMKWRYKLTLF      1 - 70
AATFVMTWFLFGVIYYAIAFIHGDLEPGEPISNHTPCIMKVDSLTGAFLFSLESQTTIGYGVRSITEECP     71 - 140
HAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKFSHCAVITKQNGKLCLVIQVANMRKSLLIQC    141 - 210
QLSGKLLQTHVTKEGERILLNQATVKFHVDSSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELV    211 - 280
VLLNATVESTSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQ    281 - 350
LEEKYRQEDQRERELRTLLLQQSNV                                                 351 - 375
//

Text Mined References (27)

PMID Year Title