Property Summary

Ligand Count 2
NCBI Gene PubMed Count 36
PubMed Score 77.80
PubTator Score 62.83

Knowledge Summary

Patent (1,862)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -2.200 2.5e-04
Astrocytoma, Pilocytic -2.200 9.6e-07
atypical teratoid / rhabdoid tumor -1.400 9.3e-03
Duchenne muscular dystrophy -1.033 2.2e-05
glioblastoma -2.000 2.1e-09
group 3 medulloblastoma -2.100 6.1e-03
medulloblastoma, large-cell -1.500 4.3e-02
posterior fossa group A ependymoma -1.100 1.8e-04
primitive neuroectodermal tumor -1.700 9.9e-03
subependymal giant cell astrocytoma -2.972 9.4e-03

 IMPC Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (16)

AA Sequence

MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANMDEKSQRYLAD      1 - 70
MFTTCVDIRWRYMLLIFSLAFLASWLLFGIIFWVIAVAHGDLEPAEGRGRTPCVMQVHGFMAAFLFSIET     71 - 140
QTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVALRDGKLC    141 - 210
LMWRVGNLRKSHIVEAHVRAQLIKPRVTEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPL    211 - 280
FGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYE    281 - 350
VPSTPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGG    351 - 420
VLEQRPYRRESEI                                                             421 - 433
//

Text Mined References (36)

PMID Year Title