Property Summary

NCBI Gene PubMed Count 33
PubMed Score 73.97
PubTator Score 62.83

Knowledge Summary

Patent (1,862)

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma -2.000 2.1e-09
group 3 medulloblastoma -2.100 6.1e-03
atypical teratoid / rhabdoid tumor -1.400 9.3e-03
medulloblastoma, large-cell -1.500 4.3e-02
primitive neuroectodermal tumor -1.700 9.9e-03
Duchenne muscular dystrophy -1.033 2.2e-05
adult high grade glioma -2.200 2.5e-04
pilocytic astrocytoma -2.300 7.6e-07
posterior fossa group A ependymoma -1.100 1.8e-04
subependymal giant cell astrocytoma -2.972 9.4e-03

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (13)

PMID Text
26324774 The augmentation of Ca(2+) influx and cytokine release suggests a physiological role for Kir2.2 in TLR4-stimulated monocytes.
23269273 Unconventional role of the inwardly rectifying potassium channel Kir2.2 as a constitutive activator of RelA in cancer.
21281576 Kir2.1 and Kir2.2 have two distinct lipid requirements for activity.
20921230 KIr2.1 and Kir2.2 are directly activated by membrane phosphatidylinositol 4,5-bisphosphate.
20841375 Kir2.2 knockdown induces senescence of cancer cells by a mechanism involving reactive oxygen species accumulation.
20676672 Kir2.1 and Kir2.2 subunits exert neither a dominant nor an anomalous effect on any of the properties of heteromeric channels.
19016473 Data show that the recovery of K(ir)2.2 from inhibition by FCCP requires intracellular components, but direct depletion of ATP does not reproduce the differential inhibitory effect of FCCP.
16373386 In conclusion, the data are consistent with the universal mechanism of rectification in Kir2 channels, but also point to significant, and physiologically important, quantitative differences between Kir2 isoforms.
16258766 Results describe the regulation of inwardly rectifying potassium current and its main molecular correlates, Kir2.1, Kir2.2 and Kir2.3 channels, by endothelin-1 in human atrial cardiomyocytes.
15958527 Kir2.2 and Kir2.1 are primary determinants of endogenous K(+) conductance in HAECs under resting conditions and that Kir2.2 provides the dominant conductance in these cells.
12598232 transcripts for Kir2.2 potassium channels are identified in proliferative smooth muscle cells
12417321 Molecular cloning of functional KCNJ12 with an arginine residue at position 285.
12032359 heteromerization contributes to the phenotype of Andersen syndrome

AA Sequence

MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANMDEKSQRYLAD      1 - 70
MFTTCVDIRWRYMLLIFSLAFLASWLLFGIIFWVIAVAHGDLEPAEGRGRTPCVMQVHGFMAAFLFSIET     71 - 140
QTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVALRDGKLC    141 - 210
LMWRVGNLRKSHIVEAHVRAQLIKPRVTEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPL    211 - 280
FGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYE    281 - 350
VPSTPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGG    351 - 420
VLEQRPYRRESEI                                                             421 - 433
//

Text Mined References (33)

PMID Year Title
26324774 2015 Rise and Fall of Kir2.2 Current by TLR4 Signaling in Human Monocytes: PKC-Dependent Trafficking and PI3K-Mediated PIP2 Decrease.
23889090 2013 Altered expression of genes for Kir ion channels in dilated cardiomyopathy.
23269273 2013 Unconventional role of the inwardly rectifying potassium channel Kir2.2 as a constitutive activator of RelA in cancer.
21874019 2011 Structural basis of PIP2 activation of the classical inward rectifier K+ channel Kir2.2.
21281576 2011 Dual-mode phospholipid regulation of human inward rectifying potassium channels.
20921230 2010 Direct and specific activation of human inward rectifier K+ channels by membrane phosphatidylinositol 4,5-bisphosphate.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20841375 2010 Knockdown of inwardly rectifying potassium channel Kir2.2 suppresses tumorigenesis by inducing reactive oxygen species-mediated cellular senescence.
20676672 2010 Functional consequences of Kir2.1/Kir2.2 subunit heteromerization.
19016473 2009 Kir 2.2 inward rectifier potassium channels are inhibited by an endogenous factor in Xenopus oocytes independently from the action of a mitochondrial uncoupler.
18391953 2008 Rare independent mutations in renal salt handling genes contribute to blood pressure variation.
17185339 2007 Evidence for association of GABA(B) receptors with Kir3 channels and regulators of G protein signalling (RGS4) proteins.
16382105 2005 International Union of Pharmacology. LIV. Nomenclature and molecular relationships of inwardly rectifying potassium channels.
16373386 2006 Differential polyamine sensitivity in inwardly rectifying Kir2 potassium channels.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16258766 2006 Regulation of cardiac inwardly rectifying potassium current IK1 and Kir2.x channels by endothelin-1.
15958527 2005 Functional expression of Kir2.x in human aortic endothelial cells: the dominant role of Kir2.2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15024025 2004 Protein trafficking and anchoring complexes revealed by proteomic analysis of inward rectifier potassium channel (Kir2.x)-associated proteins.
14960569 2004 A multiprotein trafficking complex composed of SAP97, CASK, Veli, and Mint1 is associated with inward rectifier Kir2 potassium channels.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12794312 2003 Nuclear immunostaining in rat neuronal cells using two anti-Kir2.2 ion channel polyclonal antibodies.
12598232 2003 Plasticity of KIR channels in human smooth muscle cells from internal thoracic artery.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417321 2002 Identification of human Kir2.2 (KCNJ12) gene encoding functional inward rectifier potassium channel in both mammalian cells and Xenopus oocytes.
12034888 2002 A glutamate residue at the C terminus regulates activity of inward rectifier K+ channels: implication for Andersen's syndrome.
12032359 2002 Heteromerization of Kir2.x potassium channels contributes to the phenotype of Andersen's syndrome.
11181181 2001 Inward rectifier potassium channel Kir2.2 is associated with synapse-associated protein SAP97.
9533018 1997 The inwardly rectifying potassium channel subunit Kir2.2v (KCNJN1) maps to 17p11.2-->p11.1.
9430667 1998 An alternate promoter directs expression of a truncated, muscle-specific isoform of the human ankyrin 1 gene.
9027495 1997 The human inward rectifying K+ channel Kir 2.2 (KCNJ12) gene: gene structure, assignment to chromosome 17p11.1, and identification of a simple tandem repeat polymorphism.
8647284 1996 Kir2.2v: a possible negative regulator of the inwardly rectifying K+ channel Kir2.2.
7859381 1995 Cloning and functional expression of an inwardly rectifying K+ channel from human atrium.