Property Summary

NCBI Gene PubMed Count 27
PubMed Score 48.40
PubTator Score 21.98

Knowledge Summary

Patent (2,767)

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.700 4.4e-03
ependymoma -3.500 6.6e-16
oligodendroglioma -2.700 1.1e-02
glioblastoma -4.300 2.5e-06
sonic hedgehog group medulloblastoma -2.900 4.9e-05
atypical teratoid / rhabdoid tumor -4.900 2.3e-13
medulloblastoma, large-cell -3.200 1.0e-05
primitive neuroectodermal tumor -3.900 6.3e-06
pediatric high grade glioma -3.300 1.1e-06
pilocytic astrocytoma -1.500 3.0e-04
lung carcinoma 2.100 5.1e-12
Pick disease -1.200 1.2e-03
ovarian cancer -1.100 4.4e-05

Protein-protein Interaction (6)

Gene RIF (18)

PMID Text
24811166 Subunit counting by single-molecule imaging revealed that the bound number of KChIP4 in each Kv4.2.KChIP4 complex was dependent on the expression level of KChIP4.
23576435 KChIP4a suppresses A-type Kv4 current via ER retention and enhancement of Kv4 closed-state inactivation.
23457522 Genome-wide association study identifies KCNIP4 as an asthma gene in human and in mouse.
22981920 genetic association studies in populations in Germany: Data suggest that multiple SNPs in KCNIP4 are associated not only with attention deficit disorder with hyperactivity in children and adults but also with personality disorders.
21624954 The synthesis of the variant KCNIP4 isoform is also detrimental to brain physiology, as it results in the concomitant blockade of the fast kinetics of potassium channels.
20877300 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20670164 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20045463 These data demonstrate that PKA phosphorylation of Kv4.2 plays an important role in the trafficking of Kv4.2 through its specific interaction with KChIP4a.
19910543 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
18957440 KChIP4a, KChIP2x, and KChIP3x comprise a novel class of KChIP isoforms characterized by an unusual transmembrane domain at their N termini that modulates Kv4 channel gating and trafficking.
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18393943 These results reveal a new role for KChIP3 in the regulation of calcium regulated secretion and also suggest that the functions of each of the KChIPs may be more specialized than previously appreciated.
18269347 CALP and calsenilin are involved in the trafficking of Golgi glycosyltransferases.
17981209 Mutation of KCNIP4 is associated with renal cell carcinoma.
16951992 The conformational change with metal-bound KChIP4.1 is crucial for its interaction with Kv channel but not for KChIP2.2, and that the Mg2+- and Ca2+-binding properties of KChIP2.2 and KChIP4.1 have different effects on their molecular structure.
11847232 cloning and investigation of interaction with presenilin 2 and voltage-gated potassium channel subunit Kv4

AA Sequence

MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRP      1 - 70
EALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAV     71 - 140
SFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVE    141 - 210
TFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI                                  211 - 250
//

Text Mined References (28)

PMID Year Title
24811166 2014 The stoichiometry and biophysical properties of the Kv4 potassium channel complex with K+ channel-interacting protein (KChIP) subunits are variable, depending on the relative expression level.
23576435 2013 Auxiliary KChIP4a suppresses A-type K+ current through endoplasmic reticulum (ER) retention and promoting closed-state inactivation of Kv4 channels.
23457522 2013 Integration of mouse and human genome-wide association data identifies KCNIP4 as an asthma gene.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22981920 2013 KCNIP4 as a candidate gene for personality disorders and adult ADHD.
21624954 2011 RNA polymerase III drives alternative splicing of the potassium channel-interacting protein contributing to brain complexity and neurodegeneration.
21156761 2011 A genome-wide association study suggests contrasting associations in ACPA-positive versus ACPA-negative rheumatoid arthritis.
20877300 2012 Genome-wide association study of increasing suicidal ideation during antidepressant treatment in the GENDEP project.
20670164 2010 Association of genetic polymorphisms with hepatotoxicity in patients with childhood acute lymphoblastic leukemia or lymphoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20045463 2010 KChIP4a regulates Kv4.2 channel trafficking through PKA phosphorylation.
19910543 2010 Confirmation of genomewide association signals in Chinese Han population reveals risk loci for ischemic stroke.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18957440 2008 Multiple Kv channel-interacting proteins contain an N-terminal transmembrane domain that regulates Kv4 channel trafficking and gating.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18393943 2008 Specific effects of KChIP3/calsenilin/DREAM, but not KChIPs 1, 2 and 4, on calcium signalling and regulated secretion in PC12 cells.
18269347 2008 Calsenilin and CALP interact with the cytoplasmic tail of UDP-Gal:GA2/GM2/GD2 beta-1,3-galactosyltransferase.
17981209 2007 Mapping of constitutional translocation breakpoints in renal cell cancer patients: identification of KCNIP4 as a candidate gene.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16951992 2006 Effects of metal-binding properties of human Kv channel-interacting proteins on their molecular structure and binding with Kv4.2 channel.
16112838 2005 Structure, alternative splicing, and expression of the human and mouse KCNIP gene family.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11847232 2002 Molecular cloning and characterization of CALP/KChIP4, a novel EF-hand protein interacting with presenilin 2 and voltage-gated potassium channel subunit Kv4.
11805342 2002 Elimination of fast inactivation in Kv4 A-type potassium channels by an auxiliary subunit domain.