Property Summary

NCBI Gene PubMed Count 54
PubMed Score 53.32
PubTator Score 984.13

Knowledge Summary

Patent (1,800)

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
oligodendroglioma 1.300 9.5e-03
medulloblastoma -1.200 7.6e-08
atypical teratoid / rhabdoid tumor -1.300 2.1e-07
glioblastoma -1.200 7.7e-06
medulloblastoma, large-cell -1.400 1.2e-04
adult high grade glioma -1.400 2.5e-04
non-inflammatory breast cancer -1.100 3.4e-03

Gene RIF (30)

PMID Text
26384566 downregulation of these genes through the p53-p21-DREAM-CDE/CHR pathway appears to be a principal mechanism for G2/M cell cycle arrest by p53.
26319784 The aim of this study was to investigate somatic mutations and DREAM gene expression in human multinodular goiter
23786773 Imatinib induces GIST cell quiescence in vivo and that this process also involves the DREAM complex.
23692269 Our results support the hypothesis that KChIPs enhances Kv4.2 functional expression by a 1 : 1 suppression of the N-terminal FERN domain and by producing additional positive regulatory effects on functional channel expression.
23300953 GCM1-directed villous trophoblast differentiation is repressed by DREAM
23187802 p53 can repress transcription of cell cycle genes through a p21(WAF1/CIP1)-dependent switch from MMB to DREAM protein complex binding at CHR promoter elements.
23019329 The potassium channel interacting protein 3 (DREAM/KChIP3) heterodimerizes with and regulates calmodulin function.
22730276 Genetic variation in the DREAM pathway genes was associated with the extent of pain reporting in a population-based cohort.
21852538 expression of calsenilin leads to a disruption of presenilin 1/gamma-secretase-mediated epsilon-cleavage of N-cadherin, which results in the significant accumulation of N-cadherin C-terminal fragment 1
21813705 The results show that continued human papillomavirus 16 E6/E7 expression is necessary in cervical cancer cells to prevent cell-cycle arrest by a repressive p130-DREAM complex.
21216226 These findings suggest that calsenilin degradation is primarily mediated by the UPP and that impairment in the UPP may contribute to the involvement of calsenilin in disease-associated neurodegeneration.
19730683 Observational study of gene-disease association. (HuGE Navigator)
19299442 DREAM (downstream regulatory element antagonist modulator) modulates TSHR activity through a direct protein-protein interaction that promotes coupling between the receptor and Galphas.
18957440 KChIP4a, KChIP2x, and KChIP3x comprise a novel class of KChIP isoforms characterized by an unusual transmembrane domain at their N termini that modulates Kv4 channel gating and trafficking.
18664571 Interplay of the Ca2+-binding protein DREAM with presenilin in neuronal Ca2+ signaling
18628663 Data show that calsenilin/DREAM/KChIP3 is distributed throughout the cytoplasm of SK-N-BE2(C), Jurkat, and HeLa cells and the expression of calsenilin suppresses the ATP-induced increase in intracellular Ca2+ concentrations.
18507845 DREAM transcripts are present in synovial fibroblast-like cells as well as peripheral blood mononuclear cells from osteoarthritis patients and healthy controls.
18393943 These results reveal a new role for KChIP3 in the regulation of calcium regulated secretion and also suggest that the functions of each of the KChIPs may be more specialized than previously appreciated.
18269347 CALP and calsenilin are involved in the trafficking of Golgi glycosyltransferases.
18187620 Knockdown of Kv channel interacting protein 3, calsenilin (KCNIP3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17962406 analysis of calcium-binding properties of EF-hands 3 and 4 of calsenilin
17102134 interaction of DREAM with GRK6 and GRK2, members of the G protein-coupled receptor kinase family of proteins, and their phosphorylation of DREAM
16840549 DREAM plays an important role in human calcitonin gene expression in a Ca(2+)- and cAMP-dependent manner
16306395 The downregulation of the regulator of Ca2+ homeostasis NCX3 by Ca2+-regulated DREAM is a striking example of the autoregulatory property of the Ca2+ signal in neurons.
16177826 DREAM is a Ca2+-dependent repressor of the immune response.
15770150 Calsenilin overexpression in both neurons and reactive astrocytes may play an important role in apoptosis and in Alzheimer's disease pathology.
15086516 The level of intracellular calcium can modulate the nuclear translocation of calsenilin and this process does not involve the direct binding of calcium to calsenilin
12837631 calsenilin can be phosphorylated by casein kinase I and that its phosphorylation can be regulated by intracellular calcium.
12648752 Immunoreactivity of calsenilin in the hippocampus derived from an epilepsy patient is significantly decreased compared with normal brain.
12217801 apoptosis inducers as diverse as oncoprotein inhibitors and cell death receptor activators trigger Hrk expression via blockade of DREAM in leukemia cells

AA Sequence

MQPAKEVTKASDGSLLGDLGHTPLSKKEGIKWQRPRLSRQALMRCCLVKWILSSTAPQGSDSSDSELELS      1 - 70
TVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQFFPQGDATTYAHFLFNAFDA     71 - 140
DGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRHTYPILREDA    141 - 210
PAEHVERFFEKMDRNQDGVVTIEEFLEACQKDENIMSSMQLFENVI                            211 - 256
//

Text Mined References (58)

PMID Year Title
26384566 2016 The p53-p21-DREAM-CDE/CHR pathway regulates G2/M cell cycle genes.
26319784 2015 Evaluation of Downstream Regulatory Element Antagonistic Modulator Gene in Human Multinodular Goiter.
25416956 2014 A proteome-scale map of the human interactome network.
23786773 2013 The DREAM complex mediates GIST cell quiescence and is a novel therapeutic target to enhance imatinib-induced apoptosis.
23692269 2013 Functional stoichiometry underlying KChIP regulation of Kv4.2 functional expression.
23300953 2013 DREAM mediated regulation of GCM1 in the human placental trophoblast.
23187802 2012 p53 can repress transcription of cell cycle genes through a p21(WAF1/CIP1)-dependent switch from MMB to DREAM protein complex binding at CHR promoter elements.
23019329 2012 The potassium channel interacting protein 3 (DREAM/KChIP3) heterodimerizes with and regulates calmodulin function.
22730276 2013 Investigating the role of pain-modulating pathway genes in musculoskeletal pain.
21852538 2011 Calsenilin regulates presenilin 1/?-secretase-mediated N-cadherin ?-cleavage and ?-catenin signaling.
21813705 2011 Disruption of repressive p130-DREAM complexes by human papillomavirus 16 E6/E7 oncoproteins is required for cell-cycle progression in cervical cancer cells.
21216226 2011 Calsenilin is degraded by the ubiquitin-proteasome pathway.
21070824 2011 Sumoylation regulates nuclear localization of repressor DREAM.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19299442 2009 The DREAM protein is associated with thyroid enlargement and nodular development.
18957440 2008 Multiple Kv channel-interacting proteins contain an N-terminal transmembrane domain that regulates Kv4 channel trafficking and gating.
18664571 2008 Interplay of the Ca2+-binding protein DREAM with presenilin in neuronal Ca2+ signaling.
18628663 2008 Characterization of subcellular localization and Ca2+ modulation of calsenilin/DREAM/KChIP3.
18507845 2008 DREAM is reduced in synovial fibroblasts of patients with chronic arthritic pain: is it a suitable target for peripheral pain management?
18393943 2008 Specific effects of KChIP3/calsenilin/DREAM, but not KChIPs 1, 2 and 4, on calcium signalling and regulated secretion in PC12 cells.
18269347 2008 Calsenilin and CALP interact with the cytoplasmic tail of UDP-Gal:GA2/GM2/GD2 beta-1,3-galactosyltransferase.
17962406 2007 Solution structure and calcium-binding properties of EF-hands 3 and 4 of calsenilin.
17102134 2007 G protein-coupled receptor kinase 2-mediated phosphorylation of downstream regulatory element antagonist modulator regulates membrane trafficking of Kv4.2 potassium channel.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16840549 2006 Ca2+-dependent regulation of calcitonin gene expression by the transcriptional repressor DREAM.
16306395 2005 Downstream regulatory element antagonist modulator regulates Ca2+ homeostasis and viability in cerebellar neurons.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16177826 2005 Transcriptional repressor DREAM regulates T-lymphocyte proliferation and cytokine gene expression.
16123112 2005 Multiprotein assembly of Kv4.2, KChIP3 and DPP10 produces ternary channel complexes with ISA-like properties.
16112838 2005 Structure, alternative splicing, and expression of the human and mouse KCNIP gene family.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15770150 2005 Expression of calsenilin in neurons and astrocytes in the Alzheimer's disease brain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485870 2004 KChIP3 rescues the functional expression of Shal channel tetramerization mutants.
15086516 2004 Intracellular calcium modulates the nuclear translocation of calsenilin.
14720210 2004 Induction of pro-apoptotic calsenilin/DREAM/KChIP3 in Alzheimer's disease and cultured neurons after amyloid-beta exposure.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12837631 2003 Phosphorylation of calsenilin at Ser63 regulates its cleavage by caspase-3.
12829703 2003 A fundamental role for KChIPs in determining the molecular properties and trafficking of Kv4.2 potassium channels.
12648752 2003 Reduced expression of calsenilin/DREAM/KChIP3 in the brains of kainic acid-induced seizure and epilepsy patients.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12451113 2002 PKA modulation of Kv4.2-encoded A-type potassium channels requires formation of a supramolecular complex.
12217801 2002 Fas signaling and blockade of Bcr-Abl kinase induce apoptotic Hrk protein via DREAM inhibition in human leukemia cells.
12207970 2002 Biochemical and immunocytochemical characterization of calsenilin in mouse brain.
12198160 2002 Ca2+-dependent block of CREB-CBP transcription by repressor DREAM.
12006572 2002 Palmitoylation of KChIP splicing variants is required for efficient cell surface expression of Kv4.3 channels.
11988022 2002 Calsenilin enhances apoptosis by altering endoplasmic reticulum calcium signaling.
11792319 2002 DREAM is a critical transcriptional repressor for pain modulation.
11535596 2001 Calcium-regulated DNA binding and oligomerization of the neuronal calcium-sensing protein, calsenilin/DREAM/KChIP3.
11278424 2001 Calsenilin is a substrate for caspase-3 that preferentially interacts with the familial Alzheimer's disease-associated C-terminal fragment of presenilin 2.
11259376 2001 Pro-apoptotic function of calsenilin/DREAM/KChIP3.
11094064 2000 DREAM-alphaCREM interaction via leucine-charged domains derepresses downstream regulatory element-dependent transcription.
11072133 2000 Genomic structure, expression pattern, and chromosomal localization of the human calsenilin gene: no association between an exonic polymorphism and Alzheimer's disease.
10900016 2000 Calsenilin reverses presenilin-mediated enhancement of calcium signaling.
10676964 2000 Modulation of A-type potassium channels by a family of calcium sensors.
10078534 1999 DREAM is a Ca2+-regulated transcriptional repressor.
9819380 1998 Protein kinase A-dependent derepression of the human prodynorphin gene via differential binding to an intragenic silencer element.
9771752 1998 Calsenilin: a calcium-binding protein that interacts with the presenilins and regulates the levels of a presenilin fragment.