Property Summary

NCBI Gene PubMed Count 43
PubMed Score 65.90
PubTator Score 47.25

Knowledge Summary

Patent (1,115)

Expression

  Differential Expression (13)

Protein-protein Interaction (3)

Gene RIF (21)

PMID Text
26016905 mutations cause a gainoffunction of KV4.3/KChIP2encoded channels by increasing membrane protein expression and slowing channel inactivation.
24096004 A novel KCNQ1-G229D mutation identified in a juvenile-onset AF patient altered the IKs activity and kinetics, thereby increasing the arrhythmogenicity to AF.
21422811 The "structurally minimal" isoform KChIP2d modulates recovery of K(v)4.3 N-terminal deletion mutant Delta2-39.
20709747 KChIP2 differentially regulates total and cell surface Kv4.2 protein expression and Kv4 current densities.
20649599 The I(to) activator NS5806 modified Kv4.3/KChIP2 gating in several ways that inhibit current.
20498229 The cytoplasmic accessory subunit KChIP2 also assembles with Kv4.2 to increase peak current, shift V1/2 ~5mV, slow time to peak ~10%, slow inactivation ~100%, and speed recovery from inactivation ~250% without overshoot.
20354865 N-linked glycosylation of DPP10 plays an important role in modulating Kv4.3 channel/KCHIP2 complex activities.
19927631 Down-regulated atrial KChIP2 and Kv4.3 mRNA expressions in rheumatic heart disease patients with chronic atrial fibrillation might be one of the molecular bases responsible for the down-regulation of the I(to) current density of AF.
18957440 KChIP4a, KChIP2x, and KChIP3x comprise a novel class of KChIP isoforms characterized by an unusual transmembrane domain at their N termini that modulates Kv4 channel gating and trafficking.
18501111 KChIP2c and KCNE2 simultaneously participate in recapitulation of the electrophysiological properties of transient outward current in cardiac myocytes
18393943 These results reveal a new role for KChIP3 in the regulation of calcium regulated secretion and also suggest that the functions of each of the KChIPs may be more specialized than previously appreciated.
16951992 The conformational change with metal-bound KChIP4.1 is crucial for its interaction with Kv channel but not for KChIP2.2, and that the Mg2+- and Ca2+-binding properties of KChIP2.2 and KChIP4.1 have different effects on their molecular structure.
16820361 the C-terminal domain of Kv4.2 plays a critical role in voltage-dependent activation and functional expression that is mediated by direct interaction between the Kv4.2 C terminus and KChIP2
16385451 Observational study of gene-disease association. (HuGE Navigator)
16177826 KChIP-2 is a Ca2+-dependent repressor of the immune response.
15578212 Co-expression of SGK1, but not of SGK2 or SGK3, increased Kv 4.3/KChIP2b channel currents. [KChIP2b; AH010566]
15498806 Both Kv4.3 and KChIP2 may contribute to epicardial-endocardial gradients in the transient outward current in normal and failing hearts.
15358149 Data show that KChIP1, KChIP2.1, and KChIP2.2 could form homo- as well as hetero-oligomers, and that this oligomerization did not perturb their interaction with Kv4.2 potassium channel.
14623880 Kv4.2 and K+ channel-interacting protein 2 make up a complex of Ito channels
12928444 Analysis with chimeric proteins between KChIP2 and NCS-1 reveals that the three regions of KChIP2 are necessary and sufficient for its effective binding to Kv4.3 protein
12135940 Regulation of Kv4.3 current by KChIP2 splice variants

AA Sequence

MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSETLAAPASLRPHRPR      1 - 70
LLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGD     71 - 140
SSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYD    141 - 210
MMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVI              211 - 270
//

Text Mined References (44)

PMID Year Title
26016905 2015 Two novel Brugada syndrome-associated mutations increase KV4.3 membrane expression and function.
24096004 2014 A novel KCNQ1 missense mutation identified in a patient with juvenile-onset atrial fibrillation causes constitutively open IKs channels.
21493962 2011 KCNE5 (KCNE1L) variants are novel modulators of Brugada syndrome and idiopathic ventricular fibrillation.
21422811 The "structurally minimal" isoform KChIP2d modulates recovery of K(v)4.3 N-terminal deletion mutant ?2-39.
21349352 2011 Transient outward current (I(to)) gain-of-function mutations in the KCND3-encoded Kv4.3 potassium channel and Brugada syndrome.
20709747 2010 Co-assembly of Kv4 {alpha} subunits with K+ channel-interacting protein 2 stabilizes protein expression and promotes surface retention of channel complexes.
20649599 2010 Effect of the I(to) activator NS5806 on cloned K(V)4 channels depends on the accessory protein KChIP2.
20498229 2010 The membrane protein MiRP3 regulates Kv4.2 channels in a KChIP-dependent manner.
20354865 2010 Impaired glycosylation blocks DPP10 cell surface expression and alters the electrophysiology of Ito channel complex.
19927631 2009 [Atrial myocytes KChIP2 mRNA expression in rheumatic heart disease patients with atrial fibrillation].
18957440 2008 Multiple Kv channel-interacting proteins contain an N-terminal transmembrane domain that regulates Kv4 channel trafficking and gating.
18585502 2008 Potential role of antibodies against cardiac Kv channel-interacting protein 2 in dilated cardiomyopathy.
18501111 2008 Co-expression of KCNE2 and KChIP2c modulates the electrophysiological properties of Kv4.2 current in COS-7 cells.
18393943 2008 Specific effects of KChIP3/calsenilin/DREAM, but not KChIPs 1, 2 and 4, on calcium signalling and regulated secretion in PC12 cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16951992 2006 Effects of metal-binding properties of human Kv channel-interacting proteins on their molecular structure and binding with Kv4.2 channel.
16820361 2006 C-terminal domain of Kv4.2 and associated KChIP2 interactions regulate functional expression and gating of Kv4.2.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16381901 2006 The LIFEdb database in 2006.
16177826 2005 Transcriptional repressor DREAM regulates T-lymphocyte proliferation and cytokine gene expression.
16112838 2005 Structure, alternative splicing, and expression of the human and mouse KCNIP gene family.
15578212 2005 Regulation of cardiac shal-related potassium channel Kv 4.3 by serum- and glucocorticoid-inducible kinase isoforms in Xenopus oocytes.
15498806 2004 Transmural expression of transient outward potassium current subunits in normal and failing canine and human hearts.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358149 2004 Protein-protein interactions of KChIP proteins and Kv4.2.
15356203 2004 KChIPs and Kv4 alpha subunits as integral components of A-type potassium channels in mammalian brain.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14980201 2004 Three-dimensional structure of I(to); Kv4.2-KChIP2 ion channels by electron microscopy at 21 Angstrom resolution.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623880 2004 Ito channels are octomeric complexes with four subunits of each Kv4.2 and K+ channel-interacting protein 2.
12928444 2003 Effective association of Kv channel-interacting proteins with Kv4 channel is mediated with their unique core peptide.
12829703 2003 A fundamental role for KChIPs in determining the molecular properties and trafficking of Kv4.2 potassium channels.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12297301 2002 Modulation of Kv4.3 current by accessory subunits.
12135940 2002 Regulation of Kv4.3 current by KChIP2 splice variants: a component of native cardiac I(to)?
11747815 2001 A defect in the Kv channel-interacting protein 2 (KChIP2) gene leads to a complete loss of I(to) and confers susceptibility to ventricular tachycardia.
11684073 2001 hKChIP2 is a functional modifier of hKv4.3 potassium channels: cloning and expression of a short hKChIP2 splice variant.
11351020 2001 Regulation of KChIP2 potassium channel beta subunit gene expression underlies the gradient of transient outward current in canine and human ventricle.
11287421 2001 Conserved Kv4 N-terminal domain critical for effects of Kv channel-interacting protein 2.2 on channel expression and gating.
11263977 2001 Molecular cloning and expression of the novel splice variants of K(+) channel-interacting protein 2.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10676964 2000 Modulation of A-type potassium channels by a family of calcium sensors.