Property Summary

Ligand Count 3
NCBI Gene PubMed Count 10
PubMed Score 2.62
PubTator Score 12.60

Knowledge Summary

Patent (1,909)

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma -1.150 8.5e-03
adult high grade glioma -1.100 3.2e-02
astrocytic glioma -1.700 1.4e-03
Astrocytoma, Pilocytic -1.400 3.1e-04
ependymoma -1.800 1.8e-03
glioblastoma -1.200 1.1e-02
group 3 medulloblastoma -1.500 3.7e-02
oligodendroglioma -1.800 1.2e-03
primitive neuroectodermal tumor -1.300 2.4e-02
psoriasis 1.900 3.1e-40

Gene RIF (4)

AA Sequence

MTFGRSGAASVVLNVGGARYSLSRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNEYFFDRHSEAF      1 - 70
GFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRMSDTYTFYSADEPGVLGRDEA     71 - 140
RPGGAEAAPSRRWLERMRRTFEEPTSSLAAQILASVSVVFVIVSMVVLCASTLPDWRNAAADNRSLDDRS    141 - 210
RYSAGPGREPSGIIEAICIGWFTAECIVRFIVSKNKCEFVKRPLNIIDLLAITPYYISVLMTVFTGENSQ    211 - 280
LQRAGVTLRVLRMMRIFWVIKLARHFIGLQTLGLTLKRCYREMVMLLVFICVAMAIFSALSQLLEHGLDL    281 - 350
ETSNKDFTSIPAACWWVIISMTTVGYGDMYPITVPGRILGGVCVVSGIVLLALPITFIYHSFVQCYHELK    351 - 420
FRSARYSRSLSTEFLN                                                          421 - 436
//

Text Mined References (11)

PMID Year Title