Property Summary

NCBI Gene PubMed Count 5
PubMed Score 62.65
PubTator Score 21.68

Knowledge Summary

Patent (3,478)

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.200 4.9e-02
atypical teratoid / rhabdoid tumor -2.100 4.3e-07
Down syndrome -1.300 1.0e-03
ependymoma -1.600 3.3e-09
group 3 medulloblastoma -1.400 4.3e-02
lung cancer 1.100 8.2e-03
medulloblastoma, large-cell -2.300 1.1e-03
primitive neuroectodermal tumor -1.200 2.3e-02

AA Sequence

MDGSGERSLPEPGSQSSAASDDIEIVVNVGGVRQVLYGDLLSQYPETRLAELINCLAGGYDTIFSLCDDY      1 - 70
DPGKREFYFDRDPDAFKCVIEVYYFGEVHMKKGICPICFKNEMDFWKVDLKFLDDCCKSHLSEKREELEE     71 - 140
IARRVQLILDDLGVDAAEGRWRRCQKCVWKFLEKPESSCPARVVAVLSFLLILVSSVVMCMGTIPELQVL    141 - 210
DAEGNRVEHPTLENVETACIGWFTLEYLLRLFSSPNKLHFALSFMNIVDVLAILPFYVSLTLTHLGARMM    211 - 280
ELTNVQQAVQALRIMRIARIFKLARHSSGLQTLTYALKRSFKELGLLLMYLAVGIFVFSALGYTMEQSHP    281 - 350
ETLFKSIPQSFWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPIHPIINNFVRYYNKQRVLE    351 - 420
TAAKHELELMELNSSSGGEGKTGGSRSDLDNLPPEPAGKEAPSCSSRLKLSHSDTFIPLLTEEKHHRTRL    421 - 490
QSCK                                                                      491 - 494
//

Text Mined References (7)

PMID Year Title