Property Summary

NCBI Gene PubMed Count 39
PubMed Score 39.30
PubTator Score 50.00

Knowledge Summary

Patent (2,750)

Expression

  Differential Expression (16)

 GWAS Trait (1)

Gene RIF (25)

PMID Text
26718405 KCNQ1/KCNE3 channels make only a small contribution to basolateral conductance in normal colonic crypts, with increased channel activity in UC appearing insufficient to prevent colonic cell depolarization in this disease.
26668384 Data show that voltage-gated potassium channel KCNE3 directly affects the S4 movement in potassium channel KCNQ1.
26410412 KCNE1 and KCNE3: The yin and yang of voltage-gated K(+) channel regulation
22987075 A KCNE3 T4A mutation was identified in a Japanese patient presenting Brugada-pattern ECG and neurally mediated syncope.
22190306 The results of this study indicated that Kv7.5 contributes to the spatial regulation.
21899751 Allele frequencies are studied for 11 known variants of KCNE3 gene, of which two (F66F and R83H) are polymorphic but are not associated with chronic tinnitus.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20040519 2 of the 8 MiRP2 extracellular domain acidic residues (D54 and D55) are important for KCNQ1-MiRP2 constitutive activation.
20034061 data show that SNPs in KCNE1 and KCNE3 are not associated with Meniere disease in Caucasians
20034061 Observational study of gene-disease association. (HuGE Navigator)
19961415 The KCNE3 protein within the micellesis in monomeric form and acquires mainly alpha-helical conformation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19306396 Observational study of gene-disease association. (HuGE Navigator)
19122847 KCNE3 plays a functional role in the modulation of I(to) in the human heart and suggest that mutations in KCNE3 can underlie the development of BrS.
19077539 KCNE variants reveal a critical role of the beta subunit carboxyl terminus in PKA-dependent regulation of the IKs potassium channel, KCNQ1.
18209471 Abnormalities in the KCNE3 gene is a potential genetic risk factor for initiation and/or maintenance of atrial fibrillation.
17495071 Up-regulation and incrased activity of KV3.4 channels and their accessory subunit Mirp2 induced by amyloid peptide are involved in apoptotic neuronal death.
16782062 KCNE3 also inhibits currents generated by Kv4.3 in complex with the accessory subunit KChIP2
16449802 The characterization of a missense mutation in MiRP2 that affects its phosphorylation and consequent interactions with Kv3.4 is reported.
16374062 The result indicates that 112G/A SNP in the KCNE1 gene and 198T/C SNP in the KCNE3 gene could determine an increased susceptibility to develop MD.
16308347 interaction of MiRP2-72 with KCNQ1-338; and MinK-59,58 with KCNQ1-339, 340
15212652 Observational study of gene-disease association. (HuGE Navigator)
15037716 The authors found MiRP2-R83H in 3 of 321 control subjects and in 5 unaffected related individuals. Provocation of an unaffected carrier with glucose or KCl did not induce weakness.
14504341 Observational study of gene-disease association. (HuGE Navigator)
11956246 Ectopic expression of KCNE3 accelerates cardiac repolarization and abbreviates the QT interval.

AA Sequence

METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMYILFVMFLFAV      1 - 70
TVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI                                          71 - 103
//

Text Mined References (38)

PMID Year Title
26718405 2016 Upregulation of basolateral small conductance potassium channels (KCNQ1/KCNE3) in ulcerative colitis.
26668384 2015 KCNE3 acts by promoting voltage sensor activation in KCNQ1.
26410412 2016 KCNE1 and KCNE3: The yin and yang of voltage-gated K(+) channel regulation.
22987075 2012 KCNE3 T4A as the genetic basis of Brugada-pattern electrocardiogram.
22190306 2012 Targeting of Kv7.5 (KCNQ5)/KCNE channels to surface microdomains of cell membranes.
22144915 2011 Genome-wide meta-analysis of five Asian cohorts identifies PDGFRA as a susceptibility locus for corneal astigmatism.
21899751 2011 Deep resequencing of the voltage-gated potassium channel subunit KCNE3 gene in chronic tinnitus.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20533308 2010 Impact of KCNE subunits on KCNQ1 (Kv7.1) channel membrane surface targeting.
20040519 2010 A shared mechanism for lipid- and beta-subunit-coordinated stabilization of the activated K+ channel voltage sensor.
20034061 2010 Polymorphisms in KCNE1 or KCNE3 are not associated with Ménière disease in the Caucasian population.
19961415 2009 Bacterial synthesis, purification, and solubilization of membrane protein KCNE3, a regulator of voltage-gated potassium channels.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19306396 2009 Novel KCNE3 mutation reduces repolarizing potassium current and associated with long QT syndrome.
19122847 2008 Functional effects of KCNE3 mutation and its role in the development of Brugada syndrome.
19077539 KCNE variants reveal a critical role of the beta subunit carboxyl terminus in PKA-dependent regulation of the IKs potassium channel.
18209471 2008 KCNE3 mutation V17M identified in a patient with lone atrial fibrillation.
17495071 2007 Up-regulation and increased activity of KV3.4 channels and their accessory subunit MinK-related peptide 2 induced by amyloid peptide are involved in apoptotic neuronal death.
16782062 2006 KCNE3 is an inhibitory subunit of the Kv4.3 potassium channel.
16449802 2006 Phosphorylation and protonation of neighboring MiRP2 sites: function and pathophysiology of MiRP2-Kv3.4 potassium channels in periodic paralysis.
16374062 2005 Ménière's disease is associated with single nucleotide polymorphisms in the human potassium channel genes, KCNE1 and KCNE3.
16341674 2005 Transcriptome analysis of human gastric cancer.
16308347 2006 Interaction of KCNE subunits with the KCNQ1 K+ channel pore.
16303284 2006 Expression and transcriptional control of human KCNE genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15212652 2004 No mutation in the KCNE3 potassium channel gene in Chinese thyrotoxic hypokalaemic periodic paralysis patients.
15037716 2004 Periodic paralysis mutation MiRP2-R83H in controls: Interpretations and general recommendation.
14504341 2003 Lack of association of the potassium channel-associated peptide MiRP2-R83H variant with periodic paralysis.
12954870 2003 MinK-related peptide 2 modulates Kv2.1 and Kv3.1 potassium channels in mammalian brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414843 2002 A mutation in the KCNE3 potassium channel gene is associated with susceptibility to thyrotoxic hypokalemic periodic paralysis.
11874988 2002 Disease-associated mutations in KCNE potassium channel subunits (MiRPs) reveal promiscuous disruption of multiple currents and conservation of mechanism.
11680623 2001 Colocalization of KCNQ1/KCNE channel subunits in the mouse gastrointestinal tract.
11207363 2001 MiRP2 forms potassium channels in skeletal muscle with Kv3.4 and is associated with periodic paralysis.
11104781 2001 Structural determinants of KvLQT1 control by the KCNE family of proteins.
10646604 2000 A constitutively open potassium channel formed by KCNQ1 and KCNE3.
10219239 1999 MiRP1 forms IKr potassium channels with HERG and is associated with cardiac arrhythmia.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.