Property Summary

NCBI Gene PubMed Count 79
PubMed Score 86.94
PubTator Score 92.19

Knowledge Summary

Patent (6,686)

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.400 2.5e-02
active Crohn's disease -1.006 3.6e-02
gastric carcinoma -5.300 4.6e-02

Gene RIF (62)

PMID Text
26123744 KCNE2 has been widely studied since its role in the heart was discovered; it is association with inherited and acquired human Long QT syndrome; physiological analyses together with genetics studies have uncovered a startling array of functions for KCNE2, in the heart, stomach, thyroid and choroid plexus. [Review]
24937480 Women with elevated BMI have enhanced hERG activity as a result of low beta-inhibitory protein expression, which likely contributes to weak contractions and poor labour outcomes.
24827085 The transmembrane domains (TMDs) of KCNE1 and KCNE2 were illustrated to associate with the KCNQ1 channel in different modes.
24796621 The effect of KCNE2 mutations on KV7.1 was abolished in the presence of the major IKs beta-subunit KCNE1, when coexpressed in a 1:1:1 molar ratio.
24631769 M54T MiRP1 mutation axecerbate drug-induced long QT syndrome and arrhythmia.
24460807 Mutations in KCNE2 has been shown to cause familial atrial fibrillation.
23890619 study concluded that the variants in KCNQ1, KCNH2, KCNE1 and KCNE2 genes may be correlated with the occurrence of part of sudden unexplained nocturnal death syndrome cases in southern China
23714088 Subjects with LQT-PM may have longer QTc intervals at rest and at peak exercise and all phases of the recovery period compared to controls. Those with homozygous SNPs (KCNE2 1%) had longer resting QTc intervals when compared to heterozygotes.
23504710 KCNE1 and KCNE2, auxiliary subunits of voltage-gated potassium channels, undergo sequential cleavage mediated by either alpha-secretase and presenilin(PS)/gamma-secretase or BACE1 and PS/gamma-secretase in cells.
23483772 Case Report: reduced expression of KCNE2 in surgically excised tissue from human gastric cancer associated with gastritis cystica profunda.
22180649 KCNE2 can modulate its partner channel function not only by altering channel conductance and/or gating kinetics, but also by affecting protein stability.
22166675 The known interactions of the KCNE2 protein and the resulting functional effects, the effects of mutations in KCNE2 and their clinical role are discussed. [review]
21087668 Backbone assignments of most MiRP1 residues were achieved through a series of triple resonance NMR experiments.
21063774 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21063070 Observational study of genetic testing. (HuGE Navigator)
20971364 Observational study of gene-disease association. (HuGE Navigator)
20920651 Observational study of gene-disease association. (HuGE Navigator)
20738937 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20625512 Results suggest KCNE2 disruption as a possible risk factor for gastric neoplasia.
20400777 Observational study of gene-disease association. (HuGE Navigator)
20386770 Observational study of gene-disease association. (HuGE Navigator)
20298200 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20108749 Observational study of gene-disease association. (HuGE Navigator)
20042375 KCNE2 plays a role in normal function of native I(to) channel complex in human heart, M54T and I57T variants lead to gain of function of I(to), contributing to generating potential arrhythmogeneity and pathogenesis for inherited fatal rhythm disorders.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19716085 Observational study of gene-disease association. (HuGE Navigator)
19372218 in cardiac myocytes the IKs current amplitude is under dynamic control by the availability of KCNE2 subunits in the cell membrane
19322600 Observational study of gene-disease association. (HuGE Navigator)
19219384 Human MiRP1 slowed Kv2.1 activation and deactivation twofold. Compared to wild-type human MiRP1-Kv2.1 complexes, channels formed with M54T- or I57T-MiRP1 showed greatly slowed activation (tenfold and fivefold, respectively).
19198609 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19149796 Observational study of gene-disease association. (HuGE Navigator)
19077539 KCNE variants reveal a critical role of the beta subunit carboxyl terminus in PKA-dependent regulation of the IKs potassium channel, KCNQ1.
18752142 Observational study of gene-disease association. (HuGE Navigator)
18676988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18501111 KChIP2c and KCNE2 simultaneously participate in recapitulation of the electrophysiological properties of transient outward current in cardiac myocytes
18221016 results show that MiRP1 is largely alpha helical and that the predicted transmembrane and intracellular domains in particular require extensive hydrophobic interaction for adoption of ordered, non-aggeegated structure
17905336 Observational study of genotype prevalence. (HuGE Navigator)
17895974 Results suggest that during biogenesis of channels HERG is more likely to assemble with KCNE1 than KCNE2 due to distinctly different trafficking rates and retention in the cell rather than differences in relative affinity.
17676362 We propose that the KCNE2 TMD adopts an alpha-helical secondary structure with one face making intimate contact with the KCNQ1 pore domain, while the contacts with the KCNQ1 voltage-sensing domain appear more dynamic.
17534376 Observational study of gene-disease association. (HuGE Navigator)
17310097 External pH can modify current amplitude and biophysical properties of KCNQ1. KCNE subunits work as molecular switches by modulating the pH sensitivity of human KCNQ1.
17275752 Observational study of gene-disease association. (HuGE Navigator)
17210839 Observational study of gene-disease association. (HuGE Navigator)
17210839 We demonstrated that 9.5% of cases diagnosed as SIDS carry functionally significant genetic variants in LQTS genes (KCNQ1, KCNH2, SCN5A, KCNE1, KCNE2, KCNJ2, CAV3).
16818214 Observational study of genetic testing. (HuGE Navigator)
16631607 These results suggest that KCNE2 can functionally couple to KCNQ1 even in the presence of KCNE1.
16487842 Observational study of genetic testing. (HuGE Navigator)
16487223 Observational study of genotype prevalence. (HuGE Navigator)
16414944 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
15840476 Observational study of gene-disease association. (HuGE Navigator)
15746444 Observational study of gene-disease association. (HuGE Navigator)
15368194 KCNE2 R27C is a gain-of-function mutation associated with the initiation and/or maintenance of Atrial Fibrillation.
15176425 Observational study of genotype prevalence. (HuGE Navigator)
15066947 KCNE2 protein is expressed in ventricles, and it can play diverse roles in ventricular electrical activity under (patho)physiological conditions.
15051636 Observational study of gene-disease association. (HuGE Navigator)
14760488 Observational study of gene-disease association. (HuGE Navigator)
14661677 Observational study of gene-disease association. (HuGE Navigator)
12923204 Most significant effects of MiRP1 subunits on HERG channels were more negative steady-state activation for HERG + T8A MiRP1 and more positive steady-state activation for HERG + M54T MiRP1 compared to either HERG + WT MiRP1 or HERG alone.
12856183 KCNE2, by modulating I(f) or I(h) currents, might thus contribute to the electrophysiological diversity of known pacemaking currents in the heart and brain
12185453 The accelerated inactivation time course of HERG/MiRP1(V65M) channels may decrease I(Kr) current density of myocardial cells, thereby impairing the ability of myocytes to repolarize in response to sudden membrane depolarizations such as extrasystoles.
11289718 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVS      1 - 70
TVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP                      71 - 123
//

Text Mined References (79)

PMID Year Title
26123744 2015 The KCNE2 K? channel regulatory subunit: Ubiquitous influence, complex pathobiology.
24937480 2014 Diminished hERG K+ channel activity facilitates strong human labour contractions but is dysregulated in obese women.
24827085 2014 Differential modulations of KCNQ1 by auxiliary proteins KCNE1 and KCNE2.
24796621 2014 Gain-of-function mutations in potassium channel subunit KCNE2 associated with early-onset lone atrial fibrillation.
24631769 2014 In silico screening of the impact of hERG channel kinetic abnormalities on channel block and susceptibility to acquired long QT syndrome.
24460807 2014 Single nucleotide polymorphisms in proximity to K-channel genes are associated with decreased longitudinal QTc variance.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
23890619 2013 Postmortem molecular analysis of KCNQ1, KCNH2, KCNE1 and KCNE2 genes in sudden unexplained nocturnal death syndrome in the Chinese Han population.
23714088 2013 Do LQTS gene single nucleotide polymorphisms alter QTc intervals at rest and during exercise stress testing?
23504710 2013 BACE1 and presenilin/?-secretase regulate proteolytic processing of KCNE1 and 2, auxiliary subunits of voltage-gated potassium channels.
23483772 2013 Gastric adenocarcinoma arising in gastritis cystica profunda presenting with selective loss of KCNE2 expression.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
22180649 2012 KCNE2 protein is more abundant in ventricles than in atria and can accelerate hERG protein degradation in a phosphorylation-dependent manner.
22166675 2011 The voltage-gated channel accessory protein KCNE2: multiple ion channel partners, multiple ways to long QT syndrome.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21087668 2011 Expression, purification, detergent screening and solution NMR backbone assignment of the human potassium channel accessory subunit MiRP1.
21063774 2011 Domperidone treatment for gastroparesis: demographic and pharmacogenetic characterization of clinical efficacy and side-effects.
21063070 2010 Cardiac ion channel gene mutations in Greek long QT syndrome patients.
20971364 2010 A multilocus genetic risk score for coronary heart disease: case-control and prospective cohort analyses.
20920651 2010 Prevalence and spectrum of large deletions or duplications in the major long QT syndrome-susceptibility genes and implications for long QT syndrome genetic testing.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20738937 2010 Additive effect of multiple genetic variants on the risk of coronary artery disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20625512 2010 Targeted deletion of Kcne2 causes gastritis cystica profunda and gastric neoplasia.
20533308 2010 Impact of KCNE subunits on KCNQ1 (Kv7.1) channel membrane surface targeting.
20400777 2010 Common variants in cardiac ion channel genes are associated with sudden cardiac death.
20386770 2010 Torsades de pointes during complete atrioventricular block: Genetic factors and electrocardiogram correlates.
20298200 2010 Confirmed rare copy number variants implicate novel genes in schizophrenia.
20108749 The electrocardiographic abnormalities in highly trained athletes compared to the genetic study related to causes of unexpected sudden cardiac death.
20042375 2010 KCNE2 modulation of Kv4.3 current and its potential role in fatal rhythm disorders.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19716085 2009 Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test.
19372218 2009 Dynamic partnership between KCNQ1 and KCNE1 and influence on cardiac IKs current amplitude by KCNE2.
19322600 2009 Contribution of long-QT syndrome genetic variants in sudden infant death syndrome.
19219384 2009 Regulation of the Kv2.1 potassium channel by MinK and MiRP1.
19198609 2009 Genome-wide association of early-onset myocardial infarction with single nucleotide polymorphisms and copy number variants.
19149796 2009 Relationship between genetic variants in myocardial sodium and potassium channel genes and QT interval duration in diabetics: the Diabetes Heart Study.
19077539 KCNE variants reveal a critical role of the beta subunit carboxyl terminus in PKA-dependent regulation of the IKs potassium channel.
18752142 2008 Molecular genetic analysis of long QT syndrome in Norway indicating a high prevalence of heterozygous mutation carriers.
18676988 2008 A high-density association screen of 155 ion transport genes for involvement with common migraine.
18501111 2008 Co-expression of KCNE2 and KChIP2c modulates the electrophysiological properties of Kv4.2 current in COS-7 cells.
18221016 2008 Secondary structure of the MiRP1 (KCNE2) potassium channel ancillary subunit.
17905336 2007 Long QT and Brugada syndrome gene mutations in New Zealand.
17895974 2007 Differential association between HERG and KCNE1 or KCNE2.
17676362 2007 Probing the interaction between KCNE2 and KCNQ1 in their transmembrane regions.
17534376 2007 Confirmation of associations between ion channel gene SNPs and QTc interval duration in healthy subjects.
17310097 2007 KCNE beta subunits determine pH sensitivity of KCNQ1 potassium channels.
17275752 2007 Torsades de pointes complicating atrioventricular block: evidence for a genetic predisposition.
17210839 2007 Prevalence of long-QT syndrome gene variants in sudden infant death syndrome.
16922724 2006 Spectrum of pathogenic mutations and associated polymorphisms in a cohort of 44 unrelated patients with long QT syndrome.
16818214 2006 Allelic dropout in long QT syndrome genetic testing: a possible mechanism underlying false-negative results.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16631607 2006 Modulation of functional properties of KCNQ1 channel by association of KCNE1 and KCNE2.
16487842 2006 Effect of clinical phenotype on yield of long QT syndrome genetic testing.
16487223 2006 Genetic polymorphisms in KCNQ1, HERG, KCNE1 and KCNE2 genes in the Chinese, Malay and Indian populations of Singapore.
16414944 2005 Genetic testing in the long QT syndrome: development and validation of an efficient approach to genotyping in clinical practice.
16303284 2006 Expression and transcriptional control of human KCNE genes.
15840476 2005 Compendium of cardiac channel mutations in 541 consecutive unrelated patients referred for long QT syndrome genetic testing.
15746444 2005 Common variants in myocardial ion channel genes modify the QT interval in the general population: results from the KORA study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15368194 2004 Identification of a KCNE2 gain-of-function mutation in patients with familial atrial fibrillation.
15176425 2004 Four potassium channel mutations account for 73% of the genetic spectrum underlying long-QT syndrome (LQTS) and provide evidence for a strong founder effect in Finland.
15066947 2004 KCNE2 protein is expressed in ventricles of different species, and changes in its expression contribute to electrical remodeling in diseased hearts.
15051636 2004 Compound mutations: a common cause of severe long-QT syndrome.
14760488 2004 Genetic variations of KCNQ1, KCNH2, SCN5A, KCNE1, and KCNE2 in drug-induced long QT syndrome patients.
14661677 2003 Ethnic differences in cardiac potassium channel variants: implications for genetic susceptibility to sudden cardiac death and genetic testing for congenital long QT syndrome.
12923204 2003 Mutant MiRP1 subunits modulate HERG K+ channel gating: a mechanism for pro-arrhythmia in long QT syndrome type 6.
12856183 2003 KCNE2 modulates current amplitudes and activation kinetics of HCN4: influence of KCNE family members on HCN4 currents.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12185453 2002 Identification and functional characterization of a novel KCNE2 (MiRP1) mutation that alters HERG channel kinetics.
11874988 2002 Disease-associated mutations in KCNE potassium channel subunits (MiRPs) reveal promiscuous disruption of multiple currents and conservation of mechanism.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11313306 2001 The cardiac K+ channel KCNQ1 is essential for gastric acid secretion.
11289718 2001 Correlation of genetic etiology with response to beta-adrenergic blockade among symptomatic patients with familial long-QT syndrome.
11278781 2001 Analysis of the cyclic nucleotide binding domain of the HERG potassium channel and interactions with KCNE2.
11101505 2000 KCNE2 confers background current characteristics to the cardiac KCNQ1 potassium channel.
11034315 2000 M-type KCNQ2-KCNQ3 potassium channels are modulated by the KCNE2 subunit.
10830953 2000 The DNA sequence of human chromosome 21.
10219239 1999 MiRP1 forms IKr potassium channels with HERG and is associated with cardiac arrhythmia.