Property Summary

Ligand Count 6
NCBI Gene PubMed Count 62
PubMed Score 245.68
PubTator Score 110.27

Knowledge Summary

Patent (4,501)

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -3.700 3.0e-05
ependymoma -2.400 5.5e-04
fibroadenoma -1.300 1.5e-02
group 3 medulloblastoma -2.300 3.9e-02
invasive ductal carcinoma -1.200 1.2e-02
lung cancer 3.800 1.3e-06
malignant mesothelioma -2.600 1.3e-07
medulloblastoma, large-cell -4.500 2.1e-05
non primary Sjogren syndrome sicca -1.100 2.8e-02
pituitary cancer -1.600 8.6e-04
psoriasis -1.200 2.1e-18
subependymal giant cell astrocytoma -3.444 5.8e-03

Protein-protein Interaction (8)

Gene RIF (37)

AA Sequence

MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLERYPDTLLGSS      1 - 70
ERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELAFFGLIPEIIGDCCYEEYKDR     71 - 140
RRENAERLQDDADTDTAGESALPTMTARQRVWRAFENPHTSTMALVFYYVTGFFIAVSVIANVVETVPCG    141 - 210
SSPGHIKELPCGERYAVAFFCLDTACVMIFTVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMT    211 - 280
DNEDVSGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSS    281 - 350
ASKFTSIPAAFWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD    351 - 420
KRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTN    421 - 490
HEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQ    491 - 560
IRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL    561 - 630
//

Text Mined References (66)

PMID Year Title