Property Summary

Ligand Count 7
NCBI Gene PubMed Count 21
PubMed Score 56.80
PubTator Score 37.68

Knowledge Summary

Patent (1,785)

TINX Plot

  Disease (5)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.300 8.1e-05
Astrocytoma, Pilocytic -1.700 1.2e-08
atypical teratoid/rhabdoid tumor -1.200 1.0e-04
Breast cancer -1.200 7.6e-06
ependymoma -1.500 1.1e-09
glioblastoma -1.600 2.7e-10
group 3 medulloblastoma -1.400 5.0e-04
malignant mesothelioma -1.100 3.6e-05
osteosarcoma -2.144 4.3e-07

Gene RIF (8)

AA Sequence

MISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGTRLAWLADPDG      1 - 70
GGRPETDGGGVGSSGSSGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDV     71 - 140
EPCCWMTYRQHRDAEEALDIFESPDGGGSGAGPSDEAGDDERELALQRLGPHEGGAGHGAGSGGCRGWQP    141 - 210
RMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNIDRNVTEILRVGNITSVHFRREVETEPI    211 - 280
LTYIEGVCVLWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVR    281 - 350
FVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDF    351 - 420
KNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPK    421 - 490
KRKKHVPRPAQLESPMYCKSEETSPRDSTCSDTSPPAREEGMIERKRADSKQNGDANAVLSDEEGAGLTQ    491 - 560
PLASSPTPEERRALRRSTTRDRNKKAAACFLLSTGDYACADGSVRKGTFVLRDLPLQHSPEAACPPTAGT    561 - 630
LFLPH                                                                     631 - 635
//

Text Mined References (24)

PMID Year Title