Property Summary

Ligand Count 3
NCBI Gene PubMed Count 27
PubMed Score 61.88
PubTator Score 40.96

Knowledge Summary

Patent (2,281)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Spinocerebellar ataxia 13 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.200 3.5e-04
Astrocytoma, Pilocytic -1.200 3.7e-07
ependymoma -1.400 9.3e-13
glioblastoma -1.400 3.7e-10
primitive neuroectodermal tumor -1.200 2.0e-06
sonic hedgehog group medulloblastoma -1.300 5.6e-05

Gene RIF (19)

AA Sequence

MLSSVCVSSFRGRQGASKQQPAPPPQPPESPPPPPLPPQQQQPAQPGPAASPAGPPAPRGPGDRRAEPCP      1 - 70
GLPAAAMGRHGGGGGDSGKIVINVGGVRHETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGADEFFFDRH     71 - 140
PGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWMTYRQHRDAEEALDSFEAPDPAGA    141 - 210
ANAANAAGAHDGGLDDEAGAGGGGLDGAGGELKRLCFQDAGGGAGGPPGGAGGAGGTWWRRWQPRVWALF    211 - 280
EDPYSSRAARYVAFASLFFILISITTFCLETHEGFIHISNKTVTQASPIPGAPPENITNVEVETEPFLTY    281 - 350
VEGVCVVWFTFEFLMRITFCPDKVEFLKSSLNIIDCVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVR    351 - 420
ILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDILGSNHTYFKNI    421 - 490
PIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKN    491 - 560
KHIPRPPQPGSPNYCKPDPPPPPPPHPHHGSGGISPPPPITPPSMGVTVAGAYPAGPHTHPGLLRGGAGG    561 - 630
LGIMGLPPLPAPGEPCPLAQEEVIEINRADPRPNGDPAAAALAHEDCPAIDQPAMSPEDKSPITPGSRGR    631 - 700
YSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP                 701 - 757
//

Text Mined References (26)

PMID Year Title