Property Summary

Ligand Count 3
NCBI Gene PubMed Count 28
PubMed Score 275.72
PubTator Score 108.25

Knowledge Summary

Patent (9,049)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 2.1e-02
astrocytic glioma -2.200 8.2e-03
Astrocytoma, Pilocytic -1.600 4.5e-05
atypical teratoid / rhabdoid tumor -1.400 1.4e-04
ependymoma -2.200 4.1e-02
glioblastoma -1.900 1.2e-07
group 3 medulloblastoma -2.100 2.9e-03
medulloblastoma, large-cell -2.600 2.4e-05
primitive neuroectodermal tumor -1.900 2.7e-02
progressive supranuclear palsy 1.100 1.2e-02
subependymal giant cell astrocytoma -2.305 3.3e-02

Gene RIF (15)

AA Sequence

MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNY      1 - 70
YRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPG     71 - 140
DSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLE    141 - 210
THERFNPIVNKTEIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNI    211 - 280
IDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLII    281 - 350
FLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALC    351 - 420
ALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHIPRPPQLGSPNYCKSVVNSPHHSTQSDTCPL    421 - 490
AQEEILEINRAGRKPLRGMSI                                                     491 - 511
//

Text Mined References (29)

PMID Year Title