Property Summary

NCBI Gene PubMed Count 54
PubMed Score 357.57
PubTator Score 214.58

Knowledge Summary

Patent (4,428)

Expression

  Differential Expression (22)

Disease log2 FC p
glioblastoma -3.200 1.3e-03
oligodendroglioma -1.100 3.8e-06
osteosarcoma 1.717 2.3e-02
ependymoma -2.200 8.8e-10
medulloblastoma -2.200 9.3e-04
atypical teratoid / rhabdoid tumor -3.300 2.6e-07
medulloblastoma, large-cell -3.300 4.9e-05
primitive neuroectodermal tumor -2.400 9.9e-04
pancreatic ductal adenocarcinoma liver m... -2.502 2.7e-04
colon cancer -2.400 7.6e-06
breast carcinoma -1.300 3.5e-03
fibroadenoma -1.500 3.4e-02
cystic fibrosis -1.300 1.9e-04
pediatric high grade glioma -2.400 2.0e-03
pilocytic astrocytoma -1.100 2.0e-02
lung carcinoma 1.600 1.6e-25
progressive supranuclear palsy 1.300 1.9e-02
ductal carcinoma in situ -2.800 4.3e-04
invasive ductal carcinoma -3.100 1.6e-03
ovarian cancer -3.100 2.6e-15
pituitary cancer 1.300 5.3e-05
psoriasis -1.500 1.9e-51

Protein-protein Interaction (1)

Gene RIF (41)

PMID Text
26505474 KvS subunits modify the pharmacological response of Kv2 subunits when assembled in heterotetramers and illustrate the potential of KvS subunits to provide unique properties to the heterotetramers, as is the case for 4-AP on Kv2.1/Kv6.4 channels.
26503721 Epileptic V378A variant in KCNB1 changes ion selectivity, trafficking and expression of Kv2.1 channel.
26487174 inactivation regulation via Ca(2+)/calmodulin does not interfere with the beta subunit's enzymatic activity as an NADPH-dependent oxidoreductase, thus rendering the Kvb1.1 subunit a multifunctional receptor
26477325 Kv2.1 functional aberrations in humans are associated with developmental delay, infantile generalized seizures, hypotonia, and behavioural problems, and also highlight a critical role for Kv2.1 in regulating neuronal firing in neuronal circuits.
26377690 The results indicate that KCNB1 is likely associated with metabolic traits that may either predispose or protect from progression to metabolic syndrome.
26303499 HO-1 expression can strongly influence apoptosis via CO-mediated regulation of Kv2.1 activity
26242757 KCNE5 subunits may affect Kv2.1 homotetramers and Kv2.1/Kv6.4 heterotetramers in vivo, resulting in more tissue-specific fine-tuning mechanisms.
26240432 KCNB1 is a strong susceptibility gene for schizophrenia spectrum disorders in humans.
25908859 Glutamate exposure results in a loss of Kv2.1 clusters in neurons.
25164438 This study identified a de novo missense mutation in KCNB1 that encodes the KV 2.1 voltage-gated potassium channel.
24667918 Microarray analysis indicates HIV-1 Tat-induced downregulation of potassium voltage-gated channel, Shab-related subfamily, member 1 (KCNB1) in primary human brain microvascular endothelial cells
24597762 In cerebellar granule cells, regulation of Kv2.1 by GDF15 is mediated through the TGFbetaRII-activated Akt/mTOR pathway.
24086760 Microarray analysis indicates HIV-1 Tat-induced downregulation of potassium voltage-gated channel, Shab-related subfamily, member 1 (KCNB1) in primary human brain microvascular endothelial cells
23431371 The KCNB1 rs1051295 TT genotype is associated with decreased insulin sensitivity.
22560931 Somatodendritic Kv2.1 channels in the motor neurons of lower spinal cord significantly decrease correlating with experimental autoimmune encephalomyelitis severity.
22442077 The results of this study that KCNB1 is a novel mechanism of toxicity in neurodegenerative disease.
22411134 Direct interaction between syntaxin 1A and the Kv2.1 C-terminus is required for efficient insulin exocytosis and glucose-stimulated insulin secretion.
22106938 Here, we show that tyrosine phosphorylation by Src plays a fundamental role in regulating Kv2.1-mediated K(+) current enhancement. We found that the level of expression of the Kv2.1 protein is increased by Src kinase.
21455829 Functional interactions between residues in the S1, S4, and S5 domains of Kv2.1 in human were studied.
21095721 analysis of of kv2.1 channel diffusion observed by single molecule tracking in live cells
20709754 analysis of binding sites of structurally different antiarrhythmics flecainide and propafenone in the subunit interface of potassium channel Kv2.1
20566856 Data suggest that unique roles for the clustered Kv2.1 that are independent of K(+) conductance.
20547671 Taken together the observations indicate that, as in Shaker, the quinidine-promoted collapse of Shab G(K) occurs during deactivation of the channels, at the end of each activating pulse, with a probability of 0.1 per pulse at 80 mV.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19717445 in cells either infected with HCV or harboring an HCV subgenomic replicon, oxidative stress failed to initiate apoptosis via Kv2.1. The HCV NS5A protein mediated this effect by inhibiting oxidative stress-induced p38 MAPK phosphorylation of Kv2.1.
19454037 KCNB1 may be involved in the development of LV hypertrophy in humans
19265782 rs237484 is in proximity to the potassium voltage gate channel gene (KCNB1) and close to the prostaglandin I2 (prostacyclin) synthase gene (PTGIS).
19265782 Observational study of gene-disease association. (HuGE Navigator)
19223394 SUMOylation can exert a strong inhibitory action on the voltage-dependent K(+) channel Kv2.1 and can regulate cellular excitability in native beta-cells.
19074135 Mutation of histidine 105 in the T1 domain of the potassium channel Kv2.1 disrupts heteromerization with Kv6.3 and Kv6.4.
18690023 Proteomic analysis of KV2.1 channel phosphorylation sites determining cell background specific differences in function is reported.
18212012 structural analysis of the human recombinant Kv2.1 channel
16880266 Results support a model whereby an outer vestibule lysine interferes with K+ flux through the channel, and that the [K+]-dependent change in orientation of this lysine alters single channel conductance by changing the level of this interference.
16008572 native Kv2.1 polypeptides are more abundantly found in brain
15827117 formation of heteromeric Kv2.1/Kv9.3 channels of fixed stoichiometry consisting of three Kv2.1 subunits and one Kv9.3 subunit
15353504 There is a central role for developmentally regulated ductus arteriosus SMC O2-sensitive Kv channels in the functional closure of the DA.
15024041 direct functional interaction, which is modulated by permeant ions acting at the selectivity filter, between the outer vestibule of the Kv2.1 potassium channel and the voltage sensor.
12560340 exposed residues in the T1 domain of the N terminus, as well as the CTA domain in the C terminus, are important in determining channel activation kinetics and that these N- and C-terminal regions interact
12403834 SNAP-25 protein modulates Kv2.1 voltage-dependent K(+) channels in neuroendocrine islet beta-cells through an interaction with the channel N terminus.
12021261 characterization of Kv2.1
11852086 These results indicate that Kv6.3 is a novel member of the voltage-gated K(+) channel which functions as a modulatory subunit of the Kv2.1 channel.

AA Sequence

MPAGMTKHGSRSTSSLPPEPMEIVRSKACSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLL      1 - 70
EVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQK     71 - 140
KEQMNEELKREAETLREREGEEFDNTCCAEKRKKLWDLLEKPNSSVAAKILAIISIMFIVLSTIALSLNT    141 - 210
LPELQSLDEFGQSTDNPQLAHVEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLT    211 - 280
ESNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVF    281 - 350
FAEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFY    351 - 420
KEQKRQEKAIKRREALERAKRNGSIVSMNMKDAFARSIEMMDIVVEKNGENMGKKDKVQDNHLSPNKWKW    421 - 490
TKRTLSETSSSKSFETKEQGSPEKARSSSSPQHLNVQQLEDMYNKMAKTQSQPILNTKESAAQSKPKEEL    491 - 560
EMESIPSPVAPLPTRTEGVIDMRSMSSIDSFISCATDFPEATRFSHSPLTSLPSKTGGSTAPEVGWRGAL    561 - 630
GASGGRFVEANPSPDASQHSSFFIESPKSSMKTNNPLKLRALKVNFMEGDPSPLLPVLGMYHDPLRNRGS    631 - 700
AAAAVAGLECATLLDKAVLSPESSIYTTASAKTPPRSPEKHTAIAFNFEAGVHQYIDADTDDEGQLLYSV    701 - 770
DSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPTSPKFLRQNCIYSTEALTGKGPSGQEKCKLENHISPD    771 - 840
VRVLPGGGAHGSTRDQSI                                                        841 - 858
//

Text Mined References (64)

PMID Year Title
26505474 2015 Modulation of Closed-State Inactivation in Kv2.1/Kv6.4 Heterotetramers as Mechanism for 4-AP Induced Potentiation.
26503721 2015 A novel epileptic encephalopathy mutation in KCNB1 disrupts Kv2.1 ion selectivity, expression, and localization.
26487174 2015 Ca(2+)/calmodulin regulates Kv?1.1-mediated inactivation of voltage-gated K(+) channels.
26477325 2015 De novo KCNB1 mutations in infantile epilepsy inhibit repetitive neuronal firing.
26377690 2015 Association of KCNB1 polymorphisms with lipid metabolisms and insulin resistance: a case-control design of population-based cross-sectional study in Chinese Han population.
26303499 2015 Heme Oxygenase-1 Influences Apoptosis via CO-mediated Inhibition of K+ Channels.
26242757 2015 Auxiliary KCNE subunits modulate both homotetrameric Kv2.1 and heterotetrameric Kv2.1/Kv6.4 channels.
26240432 2016 AMIGO-Kv2.1 Potassium Channel Complex Is Associated With Schizophrenia-Related Phenotypes.
25908859 2015 Induction of stable ER-plasma-membrane junctions by Kv2.1 potassium channels.
25164438 2014 De novo KCNB1 mutations in epileptic encephalopathy.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24901643 2014 The subfamily-specific interaction between Kv2.1 and Kv6.4 subunits is determined by interactions between the N- and C-termini.
24597762 2014 GDF15 regulates Kv2.1-mediated outward K+ current through the Akt/mTOR signalling pathway in rat cerebellar granule cells.
24477962 2014 A unique ion channel clustering domain on the axon initial segment of mammalian neurons.
23431371 2013 An exploratory study of the association between KCNB1 rs1051295 and type 2 diabetes and its related traits in Chinese Han population.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23161216 2013 The role of voltage-gated potassium channels Kv2.1 and Kv2.2 in the regulation of insulin and somatostatin release from pancreatic islets.
22560931 2012 K+ channel alterations in the progression of experimental autoimmune encephalomyelitis.
22442077 2012 Toxic role of K+ channel oxidation in mammalian brain.
22411134 2012 The voltage-dependent potassium channel subunit Kv2.1 regulates insulin secretion from rodent and human islets independently of its electrical function.
22106938 2012 Dynamic modulation of the kv2.1 channel by SRC-dependent tyrosine phosphorylation.
21455829 2011 Functional interactions between residues in the S1, S4, and S5 domains of Kv2.1.
21095721 2010 Anomalous diffusion of kv2.1 channels observed by single molecule tracking in live cells.
20709754 2010 Overlapping binding sites of structurally different antiarrhythmics flecainide and propafenone in the subunit interface of potassium channel Kv2.1.
20566856 2010 Localization-dependent activity of the Kv2.1 delayed-rectifier K+ channel.
20547671 2010 Quinidine interaction with Shab K+ channels: pore block and irreversible collapse of the K+ conductance.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19717558 2009 Conserved negative charges in the N-terminal tetramerization domain mediate efficient assembly of Kv2.1 and Kv2.1/Kv6.4 channels.
19717445 2009 Suppression of a pro-apoptotic K+ channel as a mechanism for hepatitis C virus persistence.
19454037 2009 Genome-wide association study identifies single-nucleotide polymorphism in KCNB1 associated with left ventricular mass in humans: the HyperGEN Study.
19357235 2009 Kv2.1 and silent Kv subunits underlie the delayed rectifier K+ current in cultured small mouse DRG neurons.
19265782 2009 A quantitative trait locus for SBP maps near KCNB1 and PTGIS in a population isolate.
19223394 2009 SUMOylation regulates Kv2.1 and modulates pancreatic beta-cell excitability.
19074135 2009 Mutation of histidine 105 in the T1 domain of the potassium channel Kv2.1 disrupts heteromerization with Kv6.3 and Kv6.4.
18690023 Proteomic analyses of K(v)2.1 channel phosphorylation sites determining cell background specific differences in function.
18212012 2008 Single particle image reconstruction of the human recombinant Kv2.1 channel.
16880266 2006 Control of single channel conductance in the outer vestibule of the Kv2.1 potassium channel.
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
16008572 2005 Biochemical characterization of the native Kv2.1 potassium channel.
15858231 2005 Molecular determinants of voltage-gated potassium currents in vascular smooth muscle.
15827117 2005 Fluorescence measurements reveal stoichiometry of K+ channels formed by modulatory and delayed rectifier alpha-subunits.
15353504 2004 Oxygen-sensitive Kv channel gene transfer confers oxygen responsiveness to preterm rabbit and remodeled human ductus arteriosus: implications for infants with patent ductus arteriosus.
15024041 2004 Influence of permeant ions on voltage sensor function in the Kv2.1 potassium channel.
14988243 2004 Expression of voltage-gated potassium channels in human and rhesus pancreatic islets.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14565763 2003 Structural basis of binding and inhibition of novel tarantula toxins in mammalian voltage-dependent potassium channels.
12615930 2003 Phosphorylation-dependent regulation of Kv2.1 Channel activity at tyrosine 124 by Src and by protein-tyrosine phosphatase epsilon.
12560340 2003 The Roles of N- and C-terminal determinants in the activation of the Kv2.1 potassium channel.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12403834 2002 Synaptosome-associated protein of 25 kilodaltons modulates Kv2.1 voltage-dependent K(+) channels in neuroendocrine islet beta-cells through an interaction with the channel N terminus.
12060745 2002 Obligatory heterotetramerization of three previously uncharacterized Kv channel alpha-subunits identified in the human genome.
12021261 2002 Amino-terminal determinants of U-type inactivation of voltage-gated K+ channels.
11852086 2002 Molecular cloning and characterization of Kv6.3, a novel modulatory subunit for voltage-gated K(+) channel Kv2.1.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10921884 2000 Hypomyelination and increased activity of voltage-gated K(+) channels in mice lacking protein tyrosine phosphatase epsilon.
10551266 1999 Structural and functional characterization of Kv6.2 a new gamma-subunit of voltage-gated potassium channel.
10484328 1999 Electrically silent potassium channel subunits from human lens epithelium.
10414301 1999 Molecular diversity of K+ channels.
9362476 1997 Kv2.1/Kv9.3, a novel ATP-dependent delayed-rectifier K+ channel in oxygen-sensitive pulmonary artery myocytes.
8980147 1996 Kv2.1 and electrically silent Kv6.1 potassium channel subunits combine and express a novel current.
8670833 1996 Kv8.1, a new neuronal potassium channel subunit with specific inhibitory properties towards Shab and Shaw channels.
8081723 1993 Cloning and characterization of a human delayed rectifier potassium channel gene.
7774931 1995 Physical and genetic localization of a Shab subfamily potassium channel (KCNB1) gene to chromosomal region 20q13.2.
1283219 1992 Heterologous expression of the human potassium channel Kv2.1 in clonal mammalian cells by direct cytoplasmic microinjection of cRNA.