Property Summary

Ligand Count 14
NCBI Gene PubMed Count 59
PubMed Score 386.04
PubTator Score 214.58

Knowledge Summary

Patent (4,428)

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -2.000 1.3e-03
Astrocytoma, Pilocytic -1.100 2.0e-02
atypical teratoid / rhabdoid tumor -3.300 2.6e-07
breast carcinoma -1.300 3.5e-03
colon cancer -1.500 3.0e-05
cystic fibrosis -1.300 1.9e-04
ductal carcinoma in situ -2.800 4.3e-04
ependymoma -2.200 8.8e-10
fibroadenoma -1.500 3.4e-02
glioblastoma -2.400 1.1e-05
group 3 medulloblastoma -2.200 1.5e-02
invasive ductal carcinoma -3.100 1.6e-03
lung carcinoma 1.600 1.6e-25
medulloblastoma, large-cell -3.100 2.2e-04
oligodendroglioma -1.100 3.8e-06
osteosarcoma 1.717 2.3e-02
ovarian cancer -2.300 2.7e-12
pancreatic ductal adenocarcinoma liver m... -2.502 2.7e-04
pituitary cancer 1.300 5.3e-05
primitive neuroectodermal tumor -2.300 5.3e-03
progressive supranuclear palsy 1.300 1.9e-02
psoriasis -1.500 1.9e-51

Gene RIF (47)

AA Sequence

MPAGMTKHGSRSTSSLPPEPMEIVRSKACSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLL      1 - 70
EVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQK     71 - 140
KEQMNEELKREAETLREREGEEFDNTCCAEKRKKLWDLLEKPNSSVAAKILAIISIMFIVLSTIALSLNT    141 - 210
LPELQSLDEFGQSTDNPQLAHVEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLT    211 - 280
ESNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVF    281 - 350
FAEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFY    351 - 420
KEQKRQEKAIKRREALERAKRNGSIVSMNMKDAFARSIEMMDIVVEKNGENMGKKDKVQDNHLSPNKWKW    421 - 490
TKRTLSETSSSKSFETKEQGSPEKARSSSSPQHLNVQQLEDMYNKMAKTQSQPILNTKESAAQSKPKEEL    491 - 560
EMESIPSPVAPLPTRTEGVIDMRSMSSIDSFISCATDFPEATRFSHSPLTSLPSKTGGSTAPEVGWRGAL    561 - 630
GASGGRFVEANPSPDASQHSSFFIESPKSSMKTNNPLKLRALKVNFMEGDPSPLLPVLGMYHDPLRNRGS    631 - 700
AAAAVAGLECATLLDKAVLSPESSIYTTASAKTPPRSPEKHTAIAFNFEAGVHQYIDADTDDEGQLLYSV    701 - 770
DSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPTSPKFLRQNCIYSTEALTGKGPSGQEKCKLENHISPD    771 - 840
VRVLPGGGAHGSTRDQSI                                                        841 - 858
//

Text Mined References (69)

PMID Year Title